KEGG   Sclerotinia sclerotiorum: SS1G_10041Help
Entry
SS1G_10041        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SS1G_10041
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SS1G_10041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 560 aa AA seqDB search
MAPHLKVTLYEGSERLGGWLRTKRIDVGDGEVVFEQGPRTLRPNTPAGFVTLNLIRDLGL
TEQVIKTDKTSAAALNRFIYYPDRLVCMPEPSQGTYAIAWKLLTEPVFKGFYKMLFEYKR
PRRPRELDDESVGSFLARRTGTTDIPNNLVSAVFHGIYAGDIYKLSAKSITSAQWGMEGA
YGSITAGISQMGKFQNAIPEDVDMENEEKSLFTDNERAIVEGTSVYTFRRGIGTLSEALE
SSLRSNPNVEIKLGENVGKIEYDDQKEGIKVYTTQTGEPPTFHSYVISTLSGRTLSTLTT
ASDDSFLTSLAETEAVTVMVVNLYYRDEDLLPERGFGYLIPRSIPYDQNPEFALGVVFDS
DATVGQDTVPGTKVTVMLGGHWWDDFETYPDEEEGISMAKAVLQRHLKIDQDPEMAHASL
QKDCIPQYTVGHEKRLKQAHYELLSAYKGRLAVAGNSYTGVGVNDCIKAAKVVASDVARV
FAITGKRVSARPDLLHSSAFYTDTANEKLPSFAFDHEDSISTRFVFERSYGNEMMQKGFH
LRHLNKRSLFSTDRRLRILR
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcacttaaaagttacattatacgagggcagtgaaagattaggaggctggcta
cgaacaaaacgtattgatgtgggagatggtgaagtcgtcttcgaacaaggcccgaggact
ttgagaccgaacactcctgcaggatttgttaccttgaacttgattagagatcttggtctg
actgaacaagtgattaaaaccgacaaaacgtctgccgctgccttgaatcgcttcatctat
tatccggatcgccttgtgtgcatgcctgagcctagccaaggaacttacgctattgcctgg
aagctgttaacagaaccagttttcaaaggattctacaaaatgctattcgaatataagaga
ccgagaagaccaagagaattagatgatgaatctgtgggatccttcctggccagaagaaca
gggaccacagatattccaaataatttggtgtcggccgtatttcatggtatctatgccggt
gatatctacaagttgagtgcgaagagtataacctctgcacagtggggaatggaaggcgca
tatggaagtatcactgcaggaatatctcaaatgggaaaatttcagaatgcgatacctgaa
gatgtggacatggagaatgaagaaaagagtcttttcacggacaatgagagggcaattgta
gaaggtacaagtgtatatacattccgtagaggaattggcacactttctgaagcactagag
tcttctttgcggagcaaccctaatgtcgaaatcaagctgggtgagaatgttggaaaaata
gagtacgatgatcaaaaagaaggtattaaggtctacacaacgcagaccggtgaaccacct
actttccactcttacgttatctctaccttgtcaggtcgcactctctctaccttaaccaca
gcttcagatgactctttcctcacttcactcgcagaaacagaggccgtgacggtcatggtt
gtgaatctttactaccgcgatgaagaccttctccccgaacgtggctttggatatctaatc
ccacggtccattccttatgatcaaaatccagaatttgctcttggtgtggtgtttgattca
gacgcaacagttgggcaggatactgttccaggtaccaaagttaccgttatgttgggtggc
cattggtgggacgactttgaaacatatcccgatgaggaagagggtatttctatggcaaaa
gccgtcctccaacgacacctgaaaatcgatcaagatccggaaatggcacatgcatctttg
cagaaagactgcattcctcaatatactgtgggtcatgaaaaaaggctcaagcaagcgcat
tatgagttgttgagtgcatacaaaggaagactggcagtagctggaaattcgtacactgga
gtcggtgtaaatgattgcatcaaggctgccaaagtcgtagcaagtgatgttgcacgcgta
tttgctattactggtaagagggtttctgcgcgacccgatttgttgcactcgtccgccttc
tataccgacacagcaaacgagaaacttccgtcatttgcattcgatcatgaagattccatc
tccacgaggtttgtctttgagagaagctatggaaatgaaatgatgcagaaaggttttcat
cttcgtcaccttaacaagcgaagcctcttttccactgaccgacgtcttcgaattcttcga
taa

DBGET integrated database retrieval system