KEGG   Sclerotinia sclerotiorum: SS1G_10046Help
Entry
SS1G_10046        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SS1G_10046
Peptidases [BR:ssl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SS1G_10046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1351 aa AA seqDB search
MDPSFDQDIQSPENMIVDPDEYVDPSDNEKDDIAIIDPDEPRPTPADDYEAMAELVLPPL
DQQPPILETVHNTWEIKNWHGLAKREHGPIFEAGGYPWRILMFPYGNNTDNVSFYLEHGF
EDGKPPDDFVCCLQFGLVLWNKNDPTLYTHHTAHHRFTKDEGDWGFTRFHETRKLFHHVW
PGSSPPRVLVENGEANITAYVRVVEDETGVLWHNFANYDSKKETGFVGLKNQGATCYLNS
LIQSLYFTNAFRKAVYQIPTQDEDTTTNSAYTLQRLFYQLQSSSTAVSTNELTKSFGWDT
KQIFEQQDVQELSRKLMERMEIKMKGTAAENVLPKLFCGKVRTYISCINVDYESRRVEDF
WDVQLNVSGNKNIEESFQDYIQVETMDGDNQYFAGENFKLQDAKKGVIFESFPEVLHLQL
KRFEYDIERDSMMKVNDRYEFPETFDAAPYLSDDADKSESWVYKLHGVLVHSGDLNAGHY
YAFIKPEKDGWFYKYDDDKVTKATMREVLEDNYGGEMPLLNGQVLDASQKPIIRHNSAYM
LVYIREARLDEVLFPVTNADTPAHLQRKLEEEAAFKEARRKEREEQHLYLTVRVITSETY
AAHGGHDLTMFDRSHEEDPAAAKSYKLLKKCTIKELIDVIGQDTGVDPRRLRVWFMVNRQ
NKTTRPDTPVMDFNQTIEDAHLKLAGSKTQELRLWAETAETVDSNGDAVWATHQLAKEGS
SPNRSDEIVIFLKWFNVDAQSLVGCGHIYISNQRRVEELAPFILRRMGWPEDTKLKLYEE
IKPDMIEPMKAKQSLKAAELQDGDIVCFQKALEKSSESGTGRGGSPDSNLSKSTTSIGHS
SETPSNGSVPRYQPVKTSDIIEDARQYYDFLRHRRLITFHCHPTKGSKEFNSENCESFTL
VLSAKHTYDQVAAKVGEKLDVDPNYIRFWTIAQNTGNPKTAIRRMSNQTLHTMVSTSYAT
FAGATIRADALYFEVLDISLAELDTKKSMKVSWISEGVTKEEQLDILVPKTGTVDDIISS
VIKKAQLEDEEKGGPIRAYEIHSNKIHKELPRGYPVKDITEYINIMLERIPEEELAQPNG
SQYIYAFHFQSEPSKVHSIPFKFLIVQRLDDRGRWKDHGAFDADILLTMKPSLIWCGLLA
CISPLVSATALTYKLSANEKACFYSNVDKQGAKIAFYFAVQAGGSFDVDYEVVGPNERVI
MKEEKERQGDFVFTATEVGEYRFCFNNQMSTFSEKFVDFEIAVENEPRASIPSKQGTTPE
QTSALEESIFKLSGQLSTITRNQKYFRTRENRNFSTVRSTERRIFNFSVIESLMMMCMAA
LQVFIVRFFFQGLGSQERLCVNEFGMGRERR
NT seq 4056 nt NT seq  +upstreamnt  +downstreamnt
atggatccttctttcgatcaggacatacagtcacccgagaatatgattgtcgatcctgac
gagtatgtcgacccgtcggataacgagaaggatgatattgccatcatagatccggatgaa
ccaaggccaacgcctgctgatgattatgaagctatggcagagctggtattgccaccttta
gatcaacagcctccgatattagagacggttcacaatacttgggagattaaaaactggcat
ggacttgccaaaagggaacatggtcctatttttgaggctggaggatatccatggcgtatc
ctaatgtttccctatgggaataataccgataacgtgtccttctacttggagcatggattt
gaagacggaaagcctccggacgattttgtttgttgcttacaattcggcctcgttttatgg
aacaagaatgatccaacactctacactcatcatacggcacatcatcgatttaccaaagat
gaaggggactggggctttacgcgattccatgaaacccgcaagcttttccaccatgtatgg
cccggctctagtcctccaagggttctggttgagaatggagaagcaaatataacggcgtat
gtaagagtagtcgaagacgaaactggcgttttatggcataacttcgccaactacgattcg
aagaaagaaactggatttgttgggttgaaaaatcagggagcgacctgttatttaaactcg
ctcattcagtccctgtattttactaatgctttccgaaaggcagtatatcaaattccgacg
caggacgaggacaccacgacaaacagcgcatatactttacaacgtcttttctatcagctg
caatcctcctccacggccgtgagtactaacgagctcaccaagtcctttggctgggatacg
aaacagatttttgaacagcaagatgtccaagagctttctaggaaattgatggagcgcatg
gaaataaagatgaagggaactgccgctgaaaacgtccttcctaaattgttctgtggaaaa
gtgcgaacgtacatctcctgcattaatgtcgactacgaatctcgcagagtagaagacttt
tgggatgtccagttgaatgttagcggcaacaagaacatcgaagagagtttccaggattat
attcaggttgagaccatggatggcgacaaccagtatttcgcaggtgaaaatttcaaactc
caagatgcgaagaaaggcgtcattttcgaatcgtttcccgaagttctgcatttgcagctc
aaaagattcgagtatgacattgagagagactccatgatgaaggttaatgatcgttatgag
tttccagaaacttttgatgccgcaccatatctatcggatgatgccgacaaatcggaatct
tgggtatataagttgcacggggtccttgtacacagcggagacctcaatgcagggcattat
tatgcattcatcaagccggaaaaagatggatggttttacaaatacgatgatgacaaagta
accaaagccacgatgcgagaagtcctggaggacaattatggaggggagatgcccctactg
aacggtcaagttttggacgcttcgcaaaagcctatcatacgacataacagcgcatacatg
cttgtttatattcgtgaagcaaggctcgatgaggtgttgttccctgtcaccaatgccgat
acaccggctcatcttcaaagaaaacttgaagaggaggctgctttcaaagaagcccgacgg
aaggaacgtgaagaacaacacctgtatcttaccgtcagagtgatcaccagtgaaacgtat
gcagctcatggtgggcatgatctcactatgtttgaccggagtcatgaggaggatcctgcg
gctgctaaatcctacaaactcctcaaaaagtgcacgattaaagagcttatcgatgtaatt
ggtcaggatactggagttgacccaagaaggttacgagtctggtttatggtcaaccgccaa
aataaaacaacaagaccggacacgcctgtcatggacttcaatcaaaccattgaagatgcg
catttgaaattagccggtagtaaaacacaagagttacgactgtgggctgaaacagcagaa
acagtcgactccaacggtgatgcagtgtgggcaacgcatcagttggcaaaagaaggatcg
tcccctaacagatctgatgaaattgtcatatttcttaaatggttcaatgttgatgcccag
tctctagttgggtgcggtcacatttatatcagtaatcaaaggagagttgaggaattagct
ccgttcattctaagacgcatgggatggccagaggataccaaactgaaactatacgaggag
ataaaacctgacatgattgaacctatgaaagcgaaacaatcacttaaggcagcagaactc
caggatggcgatatcgtctgcttccaaaaagctttggaaaagagttctgaaagcggaact
ggccgaggtggaagccctgacagtaatctctcaaaatcgaccacctccataggccattcc
tcggaaaccccttccaacggctcggttccgcgctaccagcctgttaaaacatctgatatc
atagaagatgcccgacagtactacgatttcctgcgtcatagaaggctcattacattccac
tgccatccaactaaaggtagcaaagaatttaattccgaaaattgcgagtcatttaccctg
gtactcagtgcaaagcatacttatgatcaggtggccgcgaaggtaggagagaagctggat
gttgatccgaattatatcagattctggaccatcgctcaaaatacgggcaatcccaaaaca
gcgatcaggcggatgtcaaatcaaactttacacactatggtcagtactagttacgctacg
tttgctggcgctactataagagcagacgctttatatttcgaggttcttgatattagcctg
gctgagctagataccaagaaatctatgaaggttagctggatcagcgagggtgtcacaaaa
gaggaacaactcgacatacttgtgcctaaaactggaactgtggatgacataatttcatcc
gtgatcaagaaagcccaattggaagacgaagaaaaaggtggtccgatccgagcatacgaa
atacacagcaacaagattcacaaagagcttcctcgtggttacccagtcaaggatatcacg
gagtacattaacattatgctagagcggataccggaagaagaattagcgcaacctaacgga
agtcaatatatctatgcatttcattttcagagcgagccaagtaaagtgcattccatccca
tttaaattcctcatcgttcaacgattagatgatcgaggacgatggaaagaccatggtgcc
tttgatgcagacattcttctaaccatgaagccgtctttaatttggtgcggccttttggca
tgcatttctcctcttgtatctgcgactgcactcacatataagcttagcgccaatgaaaag
gcatgcttttactccaatgttgacaaacaaggagccaaaatagctttctacttcgctgtt
caagctggaggctcttttgatgtggattatgaggtcgtgggtccaaatgagagagttatc
atgaaggaagaaaaggagcgacagggcgatttcgtcttcacagccacggaggtgggagaa
tacagattttgcttcaacaatcaaatgagtacattctcggaaaagtttgtcgactttgaa
attgctgttgagaatgagcctcgagcttccataccctcaaaacaaggcacaactcccgag
cagacttccgcgctggaagagtctatcttcaaactttcgggccagctatctaccattacg
agaaaccagaaatacttccgcacaagagaaaacagaaacttcagcacagtgaggagtacg
gaaaggaggatctttaatttcagtgtgattgaaagcttgatgatgatgtgtatggcggcc
ttacaagtctttattgttcggttcttcttccagggattagggagccaggaaaggctatgt
gtgaacgaattcggtatgggaagggagcgaagatga

DBGET integrated database retrieval system