KEGG   Sclerotinia sclerotiorum: SS1G_10052Help
Entry
SS1G_10052        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssl00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 605 aa AA seqDB search
MSTVQQKVATWSSIALRIVTYIFLRIIPGHPWPPIIYTLFALYVPSFIASHVTRNIYTVV
EDDIKIIITDTAHEDQPRTLSSTATHSQDKSGSNKRKDVEGEVEVKETVMIDGESPRPIH
TLLTGAPDPVSTLLSLLTFLINVGFVLATIDLVYYAKVFHPSTELSFARMGYIAPTEANL
LVREPDISKLPISVTYQLATPAAAYENPKPQLAGMIHTLSEDTDFTQALKFSLPNHPERT
YQWTTSNNHTGFFTTPPKPGHLPQSGSFTFFTSSCIKPRFPYRPFDHALAIPGFKHMADV
IKKIPGGSQFMLFLGDFIYIDVPKRFGVTVEDYRREYRQVYSSPDWPAVGQNLSWIHVLD
DHEIANDWDKKTTGIYDAAADPWHHYQTSVNPPRARQAGTYNTPRHGATYFEFTQGPASF
FLMDTRTYRDSSSDLPANSSEKSMLGAQQLADLLEFLKKPEPKGVKWKIVASSIPFTKNW
RVNSMDTWAGYLSERQIILEAMWDIGLRGGCGVVVISGDRHEFAATAFPPPSNGRWPISA
TVNEFSTSPLSGNSKLGAITIENTASDQSTLKFRLYVDGQEVWSSVLLSPPAISGGRWTK
EALWG
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagttcagcaaaaggtagccacttggagctcaatcgctttgcgaattgtgact
tatatctttcttcgcatcatccctggccatccatggcctcccatcatttacactcttttt
gcactatacgtcccctccttcattgccagccatgtaacgcggaacatatataccgtggta
gaagatgatatcaaaatcatcattactgatactgcgcacgaggaccagccgcgaacactt
tcatcgactgctacacactctcaagataaatcgggttcaaacaaacgaaaggatgtggag
ggagaagttgaggttaaggagacagtcatgatagatggggaatcaccgagaccaatacat
acacttttaacaggcgcgcctgatcctgtatcgaccttgctctcacttttgacatttttg
atcaacgtgggttttgttctggccacaattgacctagtatattatgcaaaagtttttcat
cccagcacagagctatcattcgcacgaatgggctacattgcccctacggaagcgaattta
ctcgttcgagagccagatatctctaagcttcccatatccgtcacttatcagctagcaact
ccggcagctgcttacgaaaatccgaagccacaactcgccggaatgatacacactctatca
gaagacactgacttcactcaagctttgaagttctcattgccaaatcatcctgagaggact
taccaatggaccacatcaaacaaccacactggctttttcactactcctcccaagcctgga
catcttcctcaatcagggtctttcacattttttacatctagttgtatcaaacctcgcttt
ccttacagaccttttgatcacgctttggcaattcccggcttcaagcatatggcagatgtc
attaagaaaatccctggaggttcccagtttatgctctttcttggcgactttatttacatt
gatgttccgaagaggtttggagtgactgttgaagattaccgccgcgagtacagacaggtc
tatagctctccggattggccagctgttgggcaaaatttaagctggatacacgtgctcgac
gatcatgaaattgccaatgattgggataagaaaacaacagggatttacgatgcagcagct
gatccgtggcatcattatcaaacatccgtcaaccctcctcgagctcgccaggccggaact
tataatacacctagacatggtgctacgtactttgagttcacgcaagggcccgcttcattc
ttcttaatggacactagaacataccgagattcttcttctgatcttcctgccaacagcagt
gagaagtccatgcttggtgcacaacaacttgctgatcttcttgaatttcttaagaaacct
gagccaaaaggtgtcaagtggaagatcgtagcatctagcattccattcacgaaaaattgg
cgggtcaatagtatggatacttgggctggttacctttccgagcgccagataatcctcgag
gccatgtgggatattggcctccgtggaggctgtggggttgtggttatcagtggagataga
catgaatttgccgcaaccgcctttccgcctccctcgaatggtcgttggccaatcagcgca
accgtaaatgagttttctacgagtcctctcagtggtaattcaaaattgggagctatcaca
attgaaaatacagccagcgaccaaagcactctaaaatttcgtctctatgttgatggccaa
gaggtttggtcttccgtcctcctctcaccaccagccatttctggaggtcggtggactaag
gaagctctttggggatga

DBGET integrated database retrieval system