KEGG   Sclerotinia sclerotiorum: SS1G_10528Help
Entry
SS1G_10528        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SS1G_10528
Peptidases [BR:ssl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SS1G_10528
Exosome [BR:ssl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SS1G_10528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 784 aa AA seqDB search
MSCKHVDAAELHPPGPSQAVYREDCTQCFDSIDDSTGLDVCLFCFNGGCTGDRNHSKLHK
MIKNHPLVLNIRRTRRHVVRDEPPHKMSKLAIAAETEADRYDYHTKVRCYECAVDDIDKS
SGRLSAVVDGVMKANTFSRQEEVKAWEQEFTSCEHILTLQQESARQIQSQDLGHCSLCDL
KENLWLCLQCGNLGCGRAQFGGLKGHSHGLEHKNQTSHAVAVKLGSITSDGRADVYCYAC
DEERIDEDLGKHLAHWGIILAEREKTEKSLMEMQVDENLRWEFSMTDEQGHELTKFFGGG
FTGLKNLGNSCYLASALQCLFDLPQFQKRYFSPNTDLPIVEDPAQDLETQLRKLADGLIS
GRYSFPDPATNQSKSSGVADQKGLAPSMLKYLIGRGHSEFSTMRQQDAFEFLLHVFKLVT
RSQHTAPLEDPTRAFRFVMEQRLQCLGCKKVRYRTDEQDNISIPVPLRKVKVAASTDGEP
VDEYEAVTLKECLDSFTSEEIVELTCPACGSKDGFSKRSLFQTFPEVLAVNARRFVLINW
VPTKVNVPVVIGDDKFLLDDYQSHGLQLSESLLPDADETSQPSFSANAEALQQLQAMGFP
MNRCEKALHATGNSDANTAMEWLFAHMDDADIDTPLNLSSGEATTTTIDPEKIGTLGAMG
FGPPQARKALRETNGDMERAVEWLFSHPDDQGEFEDETAVVNSNVTRDVPPGSAALPAAF
QLQSIICHKGSSIHAGHYVAFIRKKIPEDKATSWVLYNDEKVVKANDVEEMKKFAYVYFF
KRID
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtaagcatgtcgacgcagctgagctgcatccgccaggacccagccaagctgtc
taccgcgaggattgcactcaatgctttgactccatagatgattccactggcttggatgtt
tgcctgttctgcttcaacggcggctgtaccggtgataggaatcactccaaactccataag
atgataaaaaaccatcctctggttctcaatattcgaagaacaagacgccatgtggttcga
gatgaaccgcctcataagatgtccaaattagccatcgctgcagaaaccgaagccgatcga
tacgattatcatacaaaggttcgctgttatgaatgcgcggttgacgatatcgataaatcc
tccggtagactatctgcggtggtggatggtgtaatgaaagcaaatacattttcaagacag
gaagaagtaaaggcctgggagcaagagtttacatcttgcgaacatattcttaccttgcaa
caagaaagcgcacgccaaatacagtctcaagatttaggccactgttctctttgcgatctg
aaagagaacctgtggctctgcctgcaatgcggtaatctgggatgcggacgagcgcaattt
ggtggacttaagggccattctcatggcctggagcataagaatcaaactagtcatgctgtc
gcggttaaactgggatcaattacttccgatggtagggcagatgtgtactgctatgcatgc
gatgaggaacgaattgatgaagatcttggcaaacatcttgctcattggggaattatactc
gccgaacgtgagaagactgaaaaaagtttgatggagatgcaggtcgatgaaaacttacgc
tgggagttttccatgactgacgaacaagggcacgaattgacgaagttttttgggggagga
tttacagggttgaaaaatttaggcaatagctgctacctggcaagcgctctccagtgcctt
ttcgatttacctcaattccaaaagcgttacttttcaccgaatacagatctacctatcgtc
gaagatccggctcaagacttggagacgcagttgcgcaagttggcagacggtctaatatct
ggcagatattcatttccagatcccgctaccaatcaatcaaaatcaagcggtgttgcagat
cagaaggggttggcaccttcaatgttgaaatatttaattggcagaggtcattccgaattc
tcaaccatgcgtcagcaggatgcttttgaatttctcctccatgtcttcaaactggtcaca
cgttctcagcacacagctccgcttgaggatcccacacgagcctttcgcttcgtcatggag
cagcgcttgcaatgcttaggctgtaaaaaggtgcgatatcgcacggacgagcaagataac
atatctatccccgtgccactcagaaaagtaaaagtagccgctagcacagacggcgagccg
gtggacgaatatgaagctgttaccttgaaggaatgtctggacagttttacctctgaagag
atcgtggaacttacctgtccggcatgtggtagtaaggatggattctccaagcgatcgctc
ttccaaacattcccagaagttctcgctgtgaatgctagaagatttgttctcatcaactgg
gtgcctacaaaggtcaacgttccggtcgtcattggagacgataagttcctcctagatgat
tatcagtcacatggtttgcaactttcagaatcgcttcttcctgacgccgatgagacaagt
caaccttcattctccgcgaatgccgaagctttacagcagctccaggccatgggattccca
atgaaccgttgcgagaaagctctgcatgctactggaaacagtgacgccaacaccgcaatg
gagtggctcttcgcacacatggatgatgcagacattgatactccattaaatttgagctcc
ggcgaggctacaactactacaatcgaccctgagaaaatcggaaccttaggcgccatgggc
tttgggcctccacaagcacgaaaggcattgagagaaaccaatggtgatatggaacgggct
gtagaatggctcttcagccatccagacgatcaaggcgagttcgaggacgagacggctgtc
gtcaacagcaatgtcacgagagacgttcctccaggaagtgctgcgttgcctgctgcattc
cagcttcaatctatcatatgccataaaggatctagcatacatgcagggcactacgttgca
tttattcgcaaaaagatccccgaagataaagcaacatcgtgggtactgtacaacgacgag
aaagtggtaaaggcgaacgatgtcgaagagatgaagaaattcgcgtatgtttattttttc
aaaagaatcgattga

DBGET integrated database retrieval system