KEGG   Sclerotinia sclerotiorum: SS1G_10552Help
Entry
SS1G_10552        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
ssl  Sclerotinia sclerotiorum
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ssl03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MSGLFGTAATTTSTNAANTLGDLSKDIPLNNPPEDSISDLSFSPVSEHLAVASWDKKVRI
YEILSSGQSEGRALFDFEGPVFSCHWSKDGKKVVGAGADKTARVMDLESNQTVSQVAAHD
QPIKAARFFTAPQTNGEMLVTGSWDNTIKYWDLRTPNPVISVNMNHKVYTLDVQKNVLVV
GTAERFINIVDLNMPDKIKKTIQSPLKWQTRVISLFPDATGFAVGSIEGRCAIQYVEDKD
ASMNFSFKCHRDPPSNNMTNVYSVNAISFHPIHGTFSTAGSDGTFHFWDGIAKHRLKGYP
SVGGTISATAFNHTGNIFAYAVSYDWSKGYSSNTPQYPNKIMLHPVNADECKPRPGVKKR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtccggattatttggtacagcggctaccaccacctcgacgaacgcggccaatactctc
ggtgatctctcgaaagatattcccctcaataatcctccagaggatagtatttccgatctt
tcattttcgccagtttccgaacatttggctgtcgcatcgtgggataagaaagtgaggatt
tatgagattctgtcaagcgggcagagtgaaggtagggcattattcgatttcgaggggcca
gtcttcagttgtcactggtcaaaggatggaaagaaagtcgtaggcgcgggggcagacaaa
actgcgcgtgtgatggatctcgaaagcaaccagacagtatcgcaagtcgccgcgcatgat
caacctataaaggccgcgagattcttcacagcccctcagacaaacggcgaaatgcttgta
accggatcctgggataatactattaagtattgggatctgagaactcctaacccagtcatt
tcggtgaacatgaatcacaaagtctacaccttagatgtgcagaagaacgttttggttgtt
gggactgcagagcgatttatcaatatcgtcgacttgaacatgccagataagattaaaaag
accattcagagtccgttgaaatggcaaactagagttattagcttattcccggatgcgact
ggttttgctgttggcagtattgaagggagatgtgcgattcaatatgttgaagacaaggac
gccagtatgaacttctcgttcaaatgccaccgcgatccaccttcaaacaacatgaccaac
gtctactccgtgaacgcgatatcattccacccgatccatggcactttcagcactgctgga
tctgacggcaccttccatttctgggacggaatcgccaagcatagattgaagggctaccca
agcgttggaggaaccatctcagctacagcattcaatcacacaggaaacatctttgcctat
gccgttagttacgattggagtaagggatattcaagcaacacaccgcagtatccaaataag
attatgctacatcccgtgaacgcggatgagtgcaaacccagaccaggtgtcaagaagagg
tag

DBGET integrated database retrieval system