KEGG   Sclerotinia sclerotiorum: SS1G_10683Help
Entry
SS1G_10683        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS1G_10683
   00052 Galactose metabolism
    SS1G_10683
Enzymes [BR:ssl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SS1G_10683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 425 aa AA seqDB search
MISLNMISTILGALASLAAAQSPGQAYTGVAGNSTIAGSSLGPDANGKYELSAPGIRANF
IAYGASISNLFINDTSGIERDIVGGFDNATYYGIDRQHPHFGGVPGRYANRIKNSSFVID
GETYHVLPNENPTEDNPEGVDTLHGGPKGWDWRNWTVVAHTTSSITFSLTDPDGEQGFPG
EVVSYVTYTLSNMTWSFKMIAIATTKKTPIMLSSHTYWNLDGFANNETATALNHSLYLPY
GGQRIGTDSILIPTGDIIANQPQSLNDFWSTPKQIGANFSNPDLLGNCGENCTGYDTAYL
TNRDAATLSSWHVSPVARLRSAWSGIQLDIFTDQPAFQVYSCGGQNGSMALKKTQGLFNV
SDRPRTIPQYGCVVMEVEDWIDGINQPEWGRKQIWGPEDGPYVLEAKYRFSLNDTRMGLL
GEGSG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgatatcactcaatatgatatcgacaattctcggggccctagcaagcttagcagcagct
caatctcccggtcaagcatacacaggagtagccggaaacagcaccatagccggatcctct
ctcggtcccgacgcaaacggtaaatacgaactctccgcccctggtatccgagcaaacttc
atagcctacggtgcatcaatctctaatctcttcatcaacgacacctcgggtatcgaacgc
gatattgtcggaggtttcgataatgcaacttactatggaattgatagacaacatccgcat
tttggaggcgtgccaggtagatatgcaaatcgtatcaagaattcgagttttgttattgat
ggggagacgtatcatgtgttgccgaatgaaaatccgacagaggataatccggagggtgtt
gatacgttgcatggtggtccgaaaggttgggattggagaaattggactgtggttgctcat
actactagttcgattacttttagtttgacggatccagatggagaacaaggatttcccgga
gaggtcgttagttatgtgacttatactttgagtaatatgacttggtctttcaaaatgatt
gctattgctaccacaaagaaaactcctattatgttgagttctcacacttactggaacctt
gatggattcgccaacaacgaaacagctaccgctctcaaccattctctttacttaccatac
ggtggtcaaagaatcggaacagatagcattcttattcccacaggcgacatcatagcaaac
caaccccaatccctcaacgatttctggagcacccccaaacaaatcggcgccaacttcagc
aacccagacctcctcggaaactgcggcgaaaactgcaccggctacgacaccgcctacctc
accaaccgtgacgccgccactctctcctcctggcacgtttcccctgtagcacgtctccgc
tccgcctggtccggcatccaactcgacatcttcacagatcaacccgctttccaggtatat
tcctgcggaggccaaaatggatctatggcgttgaagaaaacgcagggtctgtttaatgtt
tcggatagacctcgcacgattccgcagtatggatgtgtggttatggaagtcgaggattgg
attgatgggattaatcagccggagtgggggagaaaacaaatttggggtccggaggatggt
ccgtatgttttggaggcgaagtataggtttagtttgaatgatactcggatgggtttattg
ggtgaggggtcgggttag

DBGET integrated database retrieval system