KEGG   Sclerotinia sclerotiorum: SS1G_10831Help
Entry
SS1G_10831        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00230  Purine metabolism
ssl01100  Metabolic pathways
Module
ssl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SS1G_10831
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SS1G_10831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 RsgA_GTPase MMR_HSR1 AAA_22 AAA_16 Terminase_6
Motif
Other DBs
NCBI-GeneID: 5484416
NCBI-ProteinID: XP_001588384
UniProt: A7EZR4 A0A1D9QB63
Position
Unknown
AA seq 202 aa AA seqDB search
MSPTPPTTNPIIISGPSGVGKGTLYSRLLANHPDLFTTSISHTTRAPRPGEKRDVDYYFV
PMEEFEAMIAKGDFVEHAMFGGNRYGTSRKMIEEKRGEGKIVVLDIEMEGVKQIHSLNPP
FPARYIFISPPSTADMTAYEVLEKRLRGRGTEKEESIQKRLAQAKLELEYSKTEGVHDKI
IVNDDLEVAYRELEEYIFGTEA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaacacccccaaccaccaaccccatcatcatcagcggtccctctggcgtcggc
aaaggaacactctattcgcgactcctagccaaccatcccgatctcttcacaacctccatt
tcgcacacgacgcgagcgccgcgtccgggagaaaaacgcgatgtcgattattattttgtg
ccgatggaggaattcgaggcgatgattgcgaagggcgattttgttgaacatgctatgttt
ggtgggaataggtatggcaccagtaggaagatgattgaggagaagaggggggaggggaag
attgttgtgttggatattgagatggagggagttaaacaaattcattccctcaaccctcca
ttccccgctagatatatatttatatctcctccttccacagcagatatgactgcatacgaa
gtattggagaagagactcaggggaagaggaacagagaaggaagaatcgattcagaaacgt
ttggcacaggcaaagctcgaattggagtactcgaagacggagggtgtgcatgataagatc
attgtgaatgatgatttggaggttgcgtatagggagttggaggagtatatttttggaacg
gaggcttag

DBGET integrated database retrieval system