KEGG   Sclerotinia sclerotiorum: SS1G_10831Help
Entry
SS1G_10831        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SS1G_10831
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SS1G_10831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 202 aa AA seqDB search
MSPTPPTTNPIIISGPSGVGKGTLYSRLLANHPDLFTTSISHTTRAPRPGEKRDVDYYFV
PMEEFEAMIAKGDFVEHAMFGGNRYGTSRKMIEEKRGEGKIVVLDIEMEGVKQIHSLNPP
FPARYIFISPPSTADMTAYEVLEKRLRGRGTEKEESIQKRLAQAKLELEYSKTEGVHDKI
IVNDDLEVAYRELEEYIFGTEA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaacacccccaaccaccaaccccatcatcatcagcggtccctctggcgtcggc
aaaggaacactctattcgcgactcctagccaaccatcccgatctcttcacaacctccatt
tcgcacacgacgcgagcgccgcgtccgggagaaaaacgcgatgtcgattattattttgtg
ccgatggaggaattcgaggcgatgattgcgaagggcgattttgttgaacatgctatgttt
ggtgggaataggtatggcaccagtaggaagatgattgaggagaagaggggggaggggaag
attgttgtgttggatattgagatggagggagttaaacaaattcattccctcaaccctcca
ttccccgctagatatatatttatatctcctccttccacagcagatatgactgcatacgaa
gtattggagaagagactcaggggaagaggaacagagaaggaagaatcgattcagaaacgt
ttggcacaggcaaagctcgaattggagtactcgaagacggagggtgtgcatgataagatc
attgtgaatgatgatttggaggttgcgtatagggagttggaggagtatatttttggaacg
gaggcttag

DBGET integrated database retrieval system