KEGG   Sclerotinia sclerotiorum: SS1G_10957Help
Entry
SS1G_10957        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00020  Citrate cycle (TCA cycle)
ssl00310  Lysine degradation
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
Module
ssl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SS1G_10957
  Amino acid metabolism
   00310 Lysine degradation
    SS1G_10957
Enzymes [BR:ssl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SS1G_10957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HlyD_3 Biotin_lipoyl_2 DUF1387 SOG2
Motif
Other DBs
NCBI-GeneID: 5483859
NCBI-ProteinID: XP_001587717
UniProt: A0A1D9QHD0 A7F040
AA seq 430 aa AA seqDB search
MLTRRVLTASRFLRAQRSAAPQLRYPLPVIQQFRNYADKVVKVPEMAESISEGTLKQWSK
QIGDYVEQDEEIATIETDKIDVAVNAPEAGTIKEFLANEEDTVTVGQDLVRLELGGAPEG
GNKEKASSEPKEPASKDQSTSSDPEPSKEEPKPKEQSSSSPPPEKKAEPKETPKPKPSES
KKQESSSSSSAPTLGNREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSSLMEFR
KLYKDEVLKKTGVKLGFMSAFSRASVLAMRDIPAVNASIEGPNGGDTIVYRDYVDISVAV
ATEKGLVTPVVRNTEAMDLVGIEKTIADLGKKARDNKLTIEDMAGGTFTISNGGVFGSLM
GTPIINLPQTAVLGLHAIKDKPVVVNGQIVIRPMMYLALTYDHRLLDGREAVQFLVKVKE
YIEDPRRMLL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccaggagggtcttaacagcctcgcgatttttgcgagctcaacgttcggcggca
ccgcaattgagatatcctcttccagttatccagcaatttcgcaattatgccgacaaggtt
gtcaaagtaccagagatggcagagtctatctctgaggggactttgaagcaatggtcaaaa
cagatcggtgattatgttgagcaggatgaggaaatcgctacaattgagacggataaaatc
gatgttgccgtcaatgctcctgaagctggcacaataaaggaattcttggcgaacgaagaa
gatacagttacagttggtcaagatttggtccgtcttgaacttggcggtgctccagagggt
ggtaataaagaaaaggcctcttcggaacccaaagagccagcatcgaaagaccaatcaaca
tcatcggatcctgagccatcgaaggaggagccgaaacccaaagagcaatccagctcttcc
ccacctccggagaagaaagcagagccaaaggagactcccaagcccaaaccatcggagtcc
aagaagcaagaatcatcatccagtagttccgcacctacgttgggcaaccgggaggagcgt
cgcgtcaagatgaatcggatgcgactacgtattgccgaacgtttgaagcaatcgcaaaat
accgcggcatctcttacaactttcaacgaggttgacatgtcatctttgatggaatttaga
aagctctacaaggatgaggttctcaagaagacgggcgtcaaacttgggttcatgagtgcc
ttttctcgtgcatctgtgcttgctatgcgagacattcctgctgtgaacgcatccattgag
ggtccgaacgggggtgacaccatcgtttacagggattatgtcgatatcagcgtcgccgtt
gccaccgagaagggcttggttactcctgttgttcgcaacactgaggccatggaccttgtc
ggtatcgaaaagactattgctgatttaggcaagaaggctcgtgacaacaaactcacaatt
gaagacatggctggtggcactttcactattagcaacggtggtgtgtttggttcattgatg
ggtacaccaatcatcaatcttccacaaactgcggttttgggtctacatgctatcaaggat
aagcccgttgtcgttaatggccaaattgtcattcgtcctatgatgtacctagccttgacc
tatgaccatcgtctcctcgatggaagagaggccgtccagttcctcgttaaggtgaaggag
tacatagaggacccgagaagaatgcttttgtag

DBGET integrated database retrieval system