KEGG   Sclerotinia sclerotiorum: SS1G_10957Help
Entry
SS1G_10957        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SS1G_10957
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SS1G_10957
  Amino acid metabolism
   00310 Lysine degradation
    SS1G_10957
Enzymes [BR:ssl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SS1G_10957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 430 aa AA seqDB search
MLTRRVLTASRFLRAQRSAAPQLRYPLPVIQQFRNYADKVVKVPEMAESISEGTLKQWSK
QIGDYVEQDEEIATIETDKIDVAVNAPEAGTIKEFLANEEDTVTVGQDLVRLELGGAPEG
GNKEKASSEPKEPASKDQSTSSDPEPSKEEPKPKEQSSSSPPPEKKAEPKETPKPKPSES
KKQESSSSSSAPTLGNREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSSLMEFR
KLYKDEVLKKTGVKLGFMSAFSRASVLAMRDIPAVNASIEGPNGGDTIVYRDYVDISVAV
ATEKGLVTPVVRNTEAMDLVGIEKTIADLGKKARDNKLTIEDMAGGTFTISNGGVFGSLM
GTPIINLPQTAVLGLHAIKDKPVVVNGQIVIRPMMYLALTYDHRLLDGREAVQFLVKVKE
YIEDPRRMLL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccaggagggtcttaacagcctcgcgatttttgcgagctcaacgttcggcggca
ccgcaattgagatatcctcttccagttatccagcaatttcgcaattatgccgacaaggtt
gtcaaagtaccagagatggcagagtctatctctgaggggactttgaagcaatggtcaaaa
cagatcggtgattatgttgagcaggatgaggaaatcgctacaattgagacggataaaatc
gatgttgccgtcaatgctcctgaagctggcacaataaaggaattcttggcgaacgaagaa
gatacagttacagttggtcaagatttggtccgtcttgaacttggcggtgctccagagggt
ggtaataaagaaaaggcctcttcggaacccaaagagccagcatcgaaagaccaatcaaca
tcatcggatcctgagccatcgaaggaggagccgaaacccaaagagcaatccagctcttcc
ccacctccggagaagaaagcagagccaaaggagactcccaagcccaaaccatcggagtcc
aagaagcaagaatcatcatccagtagttccgcacctacgttgggcaaccgggaggagcgt
cgcgtcaagatgaatcggatgcgactacgtattgccgaacgtttgaagcaatcgcaaaat
accgcggcatctcttacaactttcaacgaggttgacatgtcatctttgatggaatttaga
aagctctacaaggatgaggttctcaagaagacgggcgtcaaacttgggttcatgagtgcc
ttttctcgtgcatctgtgcttgctatgcgagacattcctgctgtgaacgcatccattgag
ggtccgaacgggggtgacaccatcgtttacagggattatgtcgatatcagcgtcgccgtt
gccaccgagaagggcttggttactcctgttgttcgcaacactgaggccatggaccttgtc
ggtatcgaaaagactattgctgatttaggcaagaaggctcgtgacaacaaactcacaatt
gaagacatggctggtggcactttcactattagcaacggtggtgtgtttggttcattgatg
ggtacaccaatcatcaatcttccacaaactgcggttttgggtctacatgctatcaaggat
aagcccgttgtcgttaatggccaaattgtcattcgtcctatgatgtacctagccttgacc
tatgaccatcgtctcctcgatggaagagaggccgtccagttcctcgttaaggtgaaggag
tacatagaggacccgagaagaatgcttttgtag

DBGET integrated database retrieval system