KEGG   Sclerotinia sclerotiorum: SS1G_10960Help
Entry
SS1G_10960        CDS       T01071                                 

Definition
histone H2B.1
Orthology
K11252  
histone H2B
Organism
ssl  Sclerotinia sclerotiorum
Brite
Exosome [BR:ssl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SS1G_10960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 139 aa AA seqDB search
MPPKGVASKAPAATKAPASASKAPAKSDAGKKTTAGEGKPRKKKGRKETYSSYIYKVLKQ
VHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELA
KHAVSEGTKAVTKYSSSTK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagggagttgcaagcaaagccccagctgccactaaggcacctgcatccgca
tcaaaggctccagctaagtcagatgctggaaagaaaaccaccgccggcgagggaaagcca
cgcaagaagaagggacgcaaggagacttactcttcatacatctacaaggttctcaagcaa
gtccacccagatactggtatttccaaccgcgccatgtctatcttgaactccttcgtcaac
gatatcttcgagcgcgtcgctaccgaggcctccaagctcgcagcttacaataagaagagc
accatctcatcaagagagatccaaacctccgttcgtctcattcttcccggtgaacttgca
aagcacgccgtttctgagggtaccaaggctgtcaccaagtactcttcatccacgaaataa

DBGET integrated database retrieval system