KEGG   Sclerotinia sclerotiorum: SS1G_10966Help
Entry
SS1G_10966        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ssl  Sclerotinia sclerotiorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 463 aa AA seqDB search
MDAPSVSGDYSVQSTVSDFAPRKRSLRNQRRSGSPSGVSTHLRENVMGAQEVQNGQISAS
PGTGRPKRSAQRIKRSEAGIIDDTLKPLTDEERRAWKGWCELESDPALFNFILREYGVKD
VKVQEVLGLEDEMLQYLPYEIYPQMLEIHIDTSQENQYNACATIALLNIIMNVPGLDLGD
IVSNFKSDTQFLKPAYRGQKLSQNEYIRNIHNTFARRMDILNADLALSNEVSAWENKKKT
KKKSGKTRSRSDDESGFHFIAFVPVKGVVWRLDGLQRQPVSLGQFDNDWISVARANIYQH
IGKYGDDLQFNLLSLCGSPLRAIPLELAQNIHAIKLVEALLPQQTPDSNSYAQTNVVGLI
RGPSEEFGVTDKLLQEIVLPLSTCNILERGGTDATALFKLHQQWVAEQKVLRIAYRNELS
SIKDENEQADRRKEDHTPTVYRTLRSLADKGLLKEIMEEVQST
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgccttcagtgtcgggggattattcggtacaatctacagtttcggattttgcg
ccaaggaaacgctccttgaggaatcaaaggaggtctgggtctccaagtggagtctccaca
catctgcgcgagaatgttatgggagcacaagaagtacaaaatggacaaatttcagcgagc
cccgggacaggccgtcccaaacgttccgcccaaagaatcaagagatcggaggctggtatc
atcgacgatacattaaagcccctgacggatgaggaacgcagggcctggaaagggtggtgt
gagctggaaagtgatccagcacttttcaacttcatcttacgagagtacggggtcaaggat
gtcaaggtgcaggaggttctaggtttagaggatgaaatgttacaatatctaccgtatgaa
atttaccctcagatgcttgaaatccatattgatacttctcaagaaaaccagtacaacgcc
tgtgctactattgctcttctgaacattattatgaatgtcccggggcttgatctcggagac
attgtcagcaatttcaagagcgatacccaatttctcaaaccagcatatcgcggccagaaa
ctaagccaaaatgagtacatcagaaatatccataatacatttgcccgaagaatggatatt
ctaaacgcagatctcgctctttcgaatgaggtttccgcttgggagaataagaagaaaacg
aaaaagaaatctggaaagaccaggtccagatcagatgatgagtcgggctttcattttatt
gcatttgttccagtgaagggcgttgtctggagacttgatggcttgcagcgtcaaccagtc
agcttaggacagtttgataatgactggatttccgttgcccgtgccaatatctaccaacat
attggcaagtacggtgatgatttgcaatttaatcttttatccttgtgtggaagtccgctc
cgcgccattcctttagaactcgcccaaaacatccacgcgatcaagcttgtcgaagctttg
ctgccgcaacaaacccccgattcaaatagctacgctcagaccaacgttgtgggactgatt
agaggaccttcagaggaatttggcgttacagacaagctacttcaggaaatagtacttcct
ttgagcacatgcaacatactcgagcgaggaggtacagacgcgaccgctcttttcaagttg
caccagcagtgggttgccgagcaaaaggtactgcgcatcgcttatagaaacgaactgtca
tcgatcaaggacgagaatgagcaggcagatagacggaaggaagatcacacgccaacggtc
tatcgcacattaagaagtctagctgataaaggcctcctaaaagagatcatggaagaagtt
cagtcgacatag

DBGET integrated database retrieval system