KEGG   Sclerotinia sclerotiorum: SS1G_11019Help
Entry
SS1G_11019        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SS1G_11019
Peptidases [BR:ssl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SS1G_11019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1165 aa AA seqDB search
MDKLLDSKNTYKFVVHQFACTATTCPVKVEVKILPPRLSASMIALLINPQDTLARGQKVI
EEDPARFPGHRPLYPFQVLGNLRKYLQDAGSENRRDIAARNKRFRLAFGDDCDVLLSYLG
FKLELRPSSNPVEEFEAFWILPVVDDKNRIFIDDITFELNQLMLERPDMEQKAPSTQTLD
SPTYALPDILRSLACDDYPKRDAVQIVDSMEHPCYASLGAIEQFTDDLLAWSYDRQCQCD
PENKPYYLDCLRELGNGRRSSDLQTKATMIMSTGEVSLKDIEKAYSFFALRRSDIKSEAD
DYIIGVYQSRIDSAPRQKDEARECLRVIAKDRRSIAIETVANDRTMTFEEALEFLSVTSD
TASDSIEAAAIAMSFEGDKGKVAKALRAIANNRGNDYTLQRAATSMESGTEDSNLDVGEA
YNRLQINDRRAPDDTVLAYYESLRAGAPAGSSDSYTEAFRVIAHDRQSSYLLRKLDDPHA
DIQAEKSTVNQPVGLDNIGNTCYLNSLLQYYYTVKSVRQVVMNFEQIRMSLNEEDIKKKR
VGGRAVSKAEIIKAQKFVMELHDLFENLKTASTRSVKPTRELAELTIFSSAAEANFRRAS
ISSPSGPPNIASMISPIFGPEGPPTVTIPPPRSTDEDIEMVERPEDKDSNQRDDSSEGTL
VEAPDMDGLPPYSDVVGKTSAAVEKVWDSKTEDTSSTFDDAVMVDGDSVSQAPDVVPTAP
EKPPPIPPRNKAGLSIQTNDEKEVITDDDLWKFGSQQDVTEVIGNVMFRLQCAIKPTSID
PVSGEQIDNIRDTFYGANASYLRKSQKLEKKVEPWANLIIFPDENKSRDIYEALDVVFDE
QQVHIDGTVQPQYASITKLPPILQVQIQRTRYDNIKHTAYKNRNAVIFPETIYLDRYMDS
EDPDSILMRRRQEAWKWKARINTLEERQRTLGQEKTAEEISVCDALSAAHSFTKSLQEMD
DIEVDTDLITMLEERQAELTQEIQRNNEEIQLLKQKRNEQFTNMTKYEYKLQTVFIHRGE
AGGGHYWIYIYDFENDVWREYNDEYVTEVRDRRRIFEHEAAGASGTPYYLGYVRSSDVKD
LVGAVHRDLREVEMPKLPPATSTNSWAKNLENGVEVHHNEDIEMGEVKNAGFVNPRHIHI
MPKKDVENKTGVTSQMPLDEHGNTW
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactccttgactcgaaaaacacttacaaatttgtggtgcatcaatttgcatgc
actgccactacctgtccagtcaaagttgaagtcaaaatattgccacctcggctgtccgcg
agtatgatagccctcctgataaatcctcaagacactttagctcgtggacagaaagtgatt
gaggaagatcccgcaagattcccaggacacaggccgttatatccatttcaggttcttggc
aatctgcgtaaatatttacaagacgcaggaagtgagaatagaagggatattgcagcgaga
aacaagaggttcagattggcattcggagacgattgtgacgtcctactgagttacctgggt
ttcaagctcgagctgagaccatcgtccaatcccgtagaggaattcgaagcattttggatt
ttacccgttgtcgatgataagaaccgcatattcatagacgatatcacgttcgagctcaac
cagctcatgcttgagcgaccagatatggagcaaaaggcaccttcaactcaaaccctcgac
tctcccacctatgctttacctgatattttacgatctttggcttgcgatgactatccgaaa
agagatgctgttcaaatcgtggattctatggagcatccatgttacgctagtctaggcgca
atcgaacaattcacggatgacctcttagcttggagttatgatcgacaatgtcaatgtgac
ccggagaacaagccatactatctggactgtttgcgggagcttggaaacggacgccgcagt
tccgatcttcaaacgaaagctacaatgatcatgtctactggagaagtcagtctgaaagat
atcgagaaagcttactcattctttgcgcttcggagaagcgatatcaagtctgaggccgat
gactacattattggtgtttatcagtctcgtattgactctgcacctcgccagaaagacgag
gcacgcgaatgtctgcgtgtgatagcaaaggataggcggagcattgctatagaaactgta
gcgaatgataggacaatgacgtttgaggaagctctcgaattcctaagtgtcacttcagat
actgcctcggatagcattgaagctgccgcaatcgccatgtccttcgaaggtgacaagggt
aaagtcgcaaaagccttgagggctattgctaacaaccgcggaaatgattacaccctgcag
cgtgcggctacatccatggagtcaggaactgaagattcgaatcttgacgttggcgaagca
tacaatcgacttcaaatcaacgacaggcgtgctccagatgataccgtacttgcctattac
gaaagcttgagggctggtgctcctgctggatcatcggatagctacacagaggcgtttcgg
gtgatagctcatgatcgacagagtagctacttgttaagaaaacttgatgatccacatgct
gatatccaagcggaaaagtcaacagttaatcaacctgttggtctggacaacattgggaac
acttgctatctgaacagcctccttcaatattactacacggtcaaatctgttcgacaggta
gttatgaattttgaacaaattcgcatgtctttaaatgaggaggatatcaagaagaagcgt
gttggaggtcgtgcggtcagtaaagctgaaatcatcaaggctcaaaaattcgtgatggaa
ttacacgacctttttgaaaatctgaagactgcctcaacaagatccgtcaagcctaccaga
gagttagccgaattgactatatttagctcagcagctgaagcgaattttcgacgagcttct
atcagtagtccaagtggtcctccgaacatcgcatccatgataagccccatctttggacca
gaagggcccccgacggttacaatccctcctccacgttcaactgatgaggacattgaaatg
gtcgaacgacctgaagacaaagactcaaatcaacgcgatgatagtagtgaaggcacatta
gtagaggcaccagacatggatggtctacctccatactctgatgttgtaggtaaaacaagt
gcggcagtagaaaaagtctgggacagcaagacagaggacactagcagtacatttgacgat
gctgtcatggtcgatggtgattcggtatcccaagctccggacgtcgtccccactgcacca
gaaaagccacctccaatccctccaagaaataaagctggcctttccatacagacaaatgat
gaaaaagaggtcatcaccgacgatgacttatggaaatttggatcccagcaagatgttaca
gaggtcatcggaaacgtgatgtttcgtttacaatgtgctattaaaccaaccagtatcgat
cctgtatctggtgagcaaatcgacaatatcagggacacattttatggtgcaaatgcatcc
taccttagaaagtcgcaaaagttagaaaagaaagttgagccatgggctaatcttatcatt
ttcccggatgagaacaaatctcgagacatttacgaagcattagatgtggtctttgatgaa
cagcaagtacatattgatggtactgttcaaccacaatatgcatctattactaaattacct
cccatcctacaagtacaaatccaacgcacacgttacgataatatcaagcatacggcatat
aagaacagaaatgcggtaatattcccagagacgatataccttgatagatatatggactct
gaagatcctgactctattttgatgcgccggcgccaagaagcatggaaatggaaggctcgt
atcaatactctggaagagcgacaacggaccctcgggcaagagaaaacagcagaagaaatc
tctgtttgtgatgcgttatccgcagcacatagttttactaaaagtttgcaggagatggat
gatatcgaagttgacacagacttaatcacaatgctggaagaacgtcaagcagaactaact
caagagattcaaagaaataacgaagaaatccagctcctcaaacaaaaacgaaatgagcaa
ttcaccaacatgacaaagtatgaatacaaactccaaacggtatttattcatcgtggtgaa
gctggtggtggtcattactggatctatatttatgattttgagaatgatgtctggagagaa
tacaatgatgaatatgttacggaagtgcgtgatcgtcgtagaatctttgaacacgaagct
gctggtgcgagtggcactccttactatctcggctatgtacgaagttcagatgtgaaggat
ttggtaggggctgtgcatagggacttgagagaagttgagatgccaaaattacctcctgct
acaagtacgaattcgtgggctaaaaacttagagaatggtgttgaggtacatcataatgag
gatatcgagatgggggaagtgaagaatgcgggatttgtgaacccgcgacatatacacatt
atgccgaagaaggatgtagagaataagacgggtgttacttcgcaaatgccattggatgaa
catggcaatacttggtaa

DBGET integrated database retrieval system