KEGG   Sclerotinia sclerotiorum: SS1G_11021Help
Entry
SS1G_11021        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SS1G_11021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 214 aa AA seqDB search
MAWTCSGRSNGELISKMWNARLVLSERVRDAMISVDRAHFTPSQHLAYQDSPQSIGYSAT
ISAPHMHASALENLLPFLGEGKRVLDVGSGSGYLTAVLAELVFPSSTSSSTSPSTSSSSE
TSSSENPGEVKKKSGKVVGLEHIRALRDLGETNMMKSEKGKKWLQEKKVEFVLGDGRQGW
IDPDGEEGWDAIHVGAAAMEIHEALIQQLRCPGR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggacatgttcaggtcgaagtaacggggagttaatatctaagatgtggaatgcg
cgattggttcttagtgagagggttagggatgctatgatttccgtagatcgcgctcacttt
accccctcccaacatctagcctaccaagattctccccagtcaatcggttactcagctacc
atttccgcaccccatatgcatgcttccgctcttgaaaatctcctcccctttctaggtgaa
ggaaaacgagttttggatgtgggaagcggaagtggatatttaactgctgttctggcagaa
cttgtatttccctcctcaacatcttcctctacatctccatctacatcttcatcttctgaa
acctcttcgagtgagaatcccggagaagtcaaaaagaaaagcggaaaagtggtaggtttg
gaacatatcagggcattaagagatctaggagaaaccaacatgatgaagagtgaaaaaggg
aaaaaatggttacaggagaagaaagtggaatttgtccttggagatgggaggcagggatgg
atagatccggatggggaggaaggatgggatgctatacatgtaggagcagcagcgatggaa
atccacgaggcgttgattcagcagttgagatgtccgggtcgctaa

DBGET integrated database retrieval system