KEGG   Sclerotinia sclerotiorum: SS1G_11277Help
Entry
SS1G_11277        CDS       T01071                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00220  Arginine biosynthesis
ssl00330  Arginine and proline metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01230  Biosynthesis of amino acids
Module
ssl_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SS1G_11277
   00330 Arginine and proline metabolism
    SS1G_11277
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SS1G_11277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 5484124
NCBI-ProteinID: XP_001588035
UniProt: A0A1D9QG75 A7F108
Position
Unknown
AA seq 328 aa AA seqDB search
MTTTSMIQPKFLSKGDQLGVVAVGFSGGQCKPGVDAAPSALIKSGLLTQLEEELGYKLHH
DNTVHSYKELIPFEDPDHRRMKNPRAVSAVTQKLSEQVYEHAKEGRCVLTLGGDHSIAIG
SVSGTAKAIRERLGREMALIWVDAHADINTPETSDSGNVHGMPVAFLTRLAQEEKPEIFG
WLKDEHMVSVKKIVYIGLRDVDRGEKKILRENGIKAFSMHDIDRHGIGKVMEMALGHIGN
DTPIHLSFDVDALDPTYAPSTGTPVRGGLTLREGDYIAECVHETGSLIAMDLVEVNPTLE
PGINDIGAHETVRAGCSLVRCALGESLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgactaccacctcaatgattcaaccaaaattcttgtcgaaaggcgaccaacttggtgtt
gttgctgtcggattctctggtggacaatgtaaaccaggagttgatgcagcaccttcagca
ctcatcaagagtggtctacttactcaactcgaagaggaattaggatacaaacttcaccat
gataataccgtccactcctataaggaattaatcccttttgaagatccagaccaccgaagg
atgaagaacccacgcgcagtctctgccgttacacaaaagctttctgaacaagtttatgaa
catgccaaagagggtcgttgcgttttgactctgggtggtgatcattccattgctattggt
tcagtttccggaactgcaaaagcaatccgtgagcgtttaggaagagagatggcattaatt
tgggttgatgcacacgccgatatcaatacaccagaaacctccgactctggaaatgttcat
ggaatgccagtcgcatttttaacgcgccttgctcaagaagaaaagcctgaaatctttgga
tggttaaaggatgaacatatggttagcgtaaagaagattgtttatattggcttgagagat
gtggacagaggagagaagaagattctccgtgaaaatggcatcaaagcattcagcatgcat
gacattgatagacacggtattggcaaagtcatggaaatggctctcggccatattggtaac
gatacccctatccatctctctttcgatgtcgacgctctcgaccctacctacgctccttct
actggtacgcctgttcgtggaggtttgactttaagagaaggagattacattgctgaatgc
gttcacgagactggttctttgatcgccatggatttggtagaggtcaacccaacacttgaa
cctggtatcaatgatattggagcacacgagactgttagagccgggtgctcattggttaga
tgcgctttgggtgaaagcttgctatga

DBGET integrated database retrieval system