KEGG   Sclerotinia sclerotiorum: SS1G_11277Help
Entry
SS1G_11277        CDS       T01071                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssl01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ssl00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 328 aa AA seqDB search
MTTTSMIQPKFLSKGDQLGVVAVGFSGGQCKPGVDAAPSALIKSGLLTQLEEELGYKLHH
DNTVHSYKELIPFEDPDHRRMKNPRAVSAVTQKLSEQVYEHAKEGRCVLTLGGDHSIAIG
SVSGTAKAIRERLGREMALIWVDAHADINTPETSDSGNVHGMPVAFLTRLAQEEKPEIFG
WLKDEHMVSVKKIVYIGLRDVDRGEKKILRENGIKAFSMHDIDRHGIGKVMEMALGHIGN
DTPIHLSFDVDALDPTYAPSTGTPVRGGLTLREGDYIAECVHETGSLIAMDLVEVNPTLE
PGINDIGAHETVRAGCSLVRCALGESLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgactaccacctcaatgattcaaccaaaattcttgtcgaaaggcgaccaacttggtgtt
gttgctgtcggattctctggtggacaatgtaaaccaggagttgatgcagcaccttcagca
ctcatcaagagtggtctacttactcaactcgaagaggaattaggatacaaacttcaccat
gataataccgtccactcctataaggaattaatcccttttgaagatccagaccaccgaagg
atgaagaacccacgcgcagtctctgccgttacacaaaagctttctgaacaagtttatgaa
catgccaaagagggtcgttgcgttttgactctgggtggtgatcattccattgctattggt
tcagtttccggaactgcaaaagcaatccgtgagcgtttaggaagagagatggcattaatt
tgggttgatgcacacgccgatatcaatacaccagaaacctccgactctggaaatgttcat
ggaatgccagtcgcatttttaacgcgccttgctcaagaagaaaagcctgaaatctttgga
tggttaaaggatgaacatatggttagcgtaaagaagattgtttatattggcttgagagat
gtggacagaggagagaagaagattctccgtgaaaatggcatcaaagcattcagcatgcat
gacattgatagacacggtattggcaaagtcatggaaatggctctcggccatattggtaac
gatacccctatccatctctctttcgatgtcgacgctctcgaccctacctacgctccttct
actggtacgcctgttcgtggaggtttgactttaagagaaggagattacattgctgaatgc
gttcacgagactggttctttgatcgccatggatttggtagaggtcaacccaacacttgaa
cctggtatcaatgatattggagcacacgagactgttagagccgggtgctcattggttaga
tgcgctttgggtgaaagcttgctatga

DBGET integrated database retrieval system