KEGG   Sclerotinia sclerotiorum: SS1G_11284Help
Entry
SS1G_11284        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SS1G_11284
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SS1G_11284
Peptidases [BR:ssl01002]
 Metallo Peptidases
  Family M67
   SS1G_11284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 530 aa AA seqDB search
MAGSALQISKPMSIKEISAKASDFEFNPTIALKYWLRTADTLLREAHIYQAEDNDQQAYL
LFMRYAALVAEKLPEHPFAKDPETRSGLRAAQKSLPDVLDRLEKLKPGINARYNNWQRAL
ERRKEIHTARESDILRPSSRADLAASDPAIAGNTTTLAAAENGELAVKLAHKEIKRRNAV
RRATRQAGVSEEEEQERRTAGLWDDWEAALSKSGRNDEDDDMRRNMEASRRRLDGSNDIL
PDGLRRRSLKPSSRPARYVQTAIRNGSSEYRYPSISKSQPFIVDDSKPYPPSDYLPPKPP
KEEESEPSSYETPPPIPEKQSSHTRESSSSEMVGEVSKFTFRPSAYLENGKPLRTVFLPP
TLRREFLACAASNTRANLETCGMLCGTLISNALFISRLVIPEQKSTSDTCETTNEGAFFD
YCASEDLMVLGWIHTHPTQSCFMSSRDLHTHCGYQIMMPESIAIVCAPSKTPSWGVFRLT
DPPGMPAVLNCKQTGLFHPHEERNIYTDALRPGHVFEAEGLEFQVVDQRP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtcagcattacagatctcgaagcctatgagcatcaaagagatctccgccaaa
gcctcagattttgaatttaatcctactatcgccttaaaatattggttaaggacagccgat
acactcttaagagaggcacatatttatcaagcagaagacaacgatcaacaagcctacctt
ttgttcatgcgatatgcggctttagttgcagaaaagctaccggagcatccattcgcgaaa
gacccagaaactagaagtggtttaagagcagctcagaaatccctccctgatgttttagac
agactggagaaattaaagcccgggataaatgcacgctacaataactggcagagggcgctg
gaaaggaggaaagaaattcataccgcacgagagagtgatatattgcgaccatcatctaga
gcagatctggctgcttccgatcctgcgattgccggaaatacaactactttagcagctgcg
gagaacggggagctggccgtgaagttggcacataaagaaataaaaaggagaaatgctgta
cggcgtgccacaaggcaagcaggtgttagtgaagaagaagagcaggagagacgtacggcg
gggctgtgggatgactgggaagcagcgttatccaaatctggtcgcaatgatgaggatgat
gacatgcgccgaaacatggaagcttcaaggaggaggttggacggttcaaatgatattttg
ccagatggattgaggaggagatctttaaaaccctcttctcgacctgcaagatatgtgcaa
acagcgattaggaatggtagcagcgaataccgatatccgtcgatttccaagtctcaacct
ttcatcgttgatgactcaaaaccatacccaccttccgattatcttcctccaaaaccacct
aaagaagaggagtctgaaccatcaagttatgaaacacctccaccaatacctgaaaaacaa
tcatcacatacgcgtgagagctcatcatctgaaatggtcggagaagtttcaaaattcact
tttcgaccctccgcatatcttgaaaatggtaaaccccttcgaacagtttttcttccgcct
acattgcgacgagaattccttgcctgcgcagcctcaaatacacgagcgaaccttgaaact
tgtggaatgttatgcggaacgttgatatctaatgccctcttcatttctcgactcgttatc
ccagaacaaaagagtaccagcgatacgtgtgaaacaactaatgagggtgcttttttcgat
tattgcgcatctgaagatttaatggtcctaggatggatacatactcatcctacacaaagc
tgtttcatgagtagtcgagatttacatacacattgtgggtaccaaatcatgatgcctgaa
agtattgcaattgtttgcgcaccgagtaaaactccttcatggggggtcttccgtttaact
gaccctccagggatgccagctgttttgaattgtaaacagactggacttttccatccgcat
gaggaaagaaatatctacactgatgcacttcgacctggccatgtatttgaggcagaaggg
ctagaatttcaagttgttgatcagcgaccatag

DBGET integrated database retrieval system