KEGG   Sclerotinia sclerotiorum: SS1G_11284Help
Entry
SS1G_11284        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ssl04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 530 aa AA seqDB search
MAGSALQISKPMSIKEISAKASDFEFNPTIALKYWLRTADTLLREAHIYQAEDNDQQAYL
LFMRYAALVAEKLPEHPFAKDPETRSGLRAAQKSLPDVLDRLEKLKPGINARYNNWQRAL
ERRKEIHTARESDILRPSSRADLAASDPAIAGNTTTLAAAENGELAVKLAHKEIKRRNAV
RRATRQAGVSEEEEQERRTAGLWDDWEAALSKSGRNDEDDDMRRNMEASRRRLDGSNDIL
PDGLRRRSLKPSSRPARYVQTAIRNGSSEYRYPSISKSQPFIVDDSKPYPPSDYLPPKPP
KEEESEPSSYETPPPIPEKQSSHTRESSSSEMVGEVSKFTFRPSAYLENGKPLRTVFLPP
TLRREFLACAASNTRANLETCGMLCGTLISNALFISRLVIPEQKSTSDTCETTNEGAFFD
YCASEDLMVLGWIHTHPTQSCFMSSRDLHTHCGYQIMMPESIAIVCAPSKTPSWGVFRLT
DPPGMPAVLNCKQTGLFHPHEERNIYTDALRPGHVFEAEGLEFQVVDQRP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtcagcattacagatctcgaagcctatgagcatcaaagagatctccgccaaa
gcctcagattttgaatttaatcctactatcgccttaaaatattggttaaggacagccgat
acactcttaagagaggcacatatttatcaagcagaagacaacgatcaacaagcctacctt
ttgttcatgcgatatgcggctttagttgcagaaaagctaccggagcatccattcgcgaaa
gacccagaaactagaagtggtttaagagcagctcagaaatccctccctgatgttttagac
agactggagaaattaaagcccgggataaatgcacgctacaataactggcagagggcgctg
gaaaggaggaaagaaattcataccgcacgagagagtgatatattgcgaccatcatctaga
gcagatctggctgcttccgatcctgcgattgccggaaatacaactactttagcagctgcg
gagaacggggagctggccgtgaagttggcacataaagaaataaaaaggagaaatgctgta
cggcgtgccacaaggcaagcaggtgttagtgaagaagaagagcaggagagacgtacggcg
gggctgtgggatgactgggaagcagcgttatccaaatctggtcgcaatgatgaggatgat
gacatgcgccgaaacatggaagcttcaaggaggaggttggacggttcaaatgatattttg
ccagatggattgaggaggagatctttaaaaccctcttctcgacctgcaagatatgtgcaa
acagcgattaggaatggtagcagcgaataccgatatccgtcgatttccaagtctcaacct
ttcatcgttgatgactcaaaaccatacccaccttccgattatcttcctccaaaaccacct
aaagaagaggagtctgaaccatcaagttatgaaacacctccaccaatacctgaaaaacaa
tcatcacatacgcgtgagagctcatcatctgaaatggtcggagaagtttcaaaattcact
tttcgaccctccgcatatcttgaaaatggtaaaccccttcgaacagtttttcttccgcct
acattgcgacgagaattccttgcctgcgcagcctcaaatacacgagcgaaccttgaaact
tgtggaatgttatgcggaacgttgatatctaatgccctcttcatttctcgactcgttatc
ccagaacaaaagagtaccagcgatacgtgtgaaacaactaatgagggtgcttttttcgat
tattgcgcatctgaagatttaatggtcctaggatggatacatactcatcctacacaaagc
tgtttcatgagtagtcgagatttacatacacattgtgggtaccaaatcatgatgcctgaa
agtattgcaattgtttgcgcaccgagtaaaactccttcatggggggtcttccgtttaact
gaccctccagggatgccagctgttttgaattgtaaacagactggacttttccatccgcat
gaggaaagaaatatctacactgatgcacttcgacctggccatgtatttgaggcagaaggg
ctagaatttcaagttgttgatcagcgaccatag

DBGET integrated database retrieval system