KEGG   Sclerotinia sclerotiorum: SS1G_11433Help
Entry
SS1G_11433        CDS       T01071                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ssl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssl00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ssl00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ssl00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MPRQFFVGGNFKMNGSVESIKKIVGYLNDAKLDPNTEVVIAPPALYLLLTREHLRPGLEV
AAQNVFDKPNGAFTGEISVEQLKDSNITWTLLGHSERRVVLQEDDSFVASKTKAALDGGI
NVIFCCGESLEQRESGKTIEVVTAQLKAVKDKVQDWSKIVIAYEPIWAIGTGKVASTEQA
QEVHAAIRSWLKKEVSEKAAEETRIIYGGSVSEKNCKDLSKQEDIDGFLVGGASLKPAFV
DIINSHL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcaatttttcgttggaggtaacttcaagatgaatggatctgttgaatccatc
aagaagattgttggatacttgaacgatgcaaagttggacccaaataccgaggttgtcatt
gctccacccgctctttaccttctccttacccgcgagcacttgagacccggacttgaggtc
gcagctcaaaacgtttttgataagccaaatggagctttcactggtgaaatctccgttgag
caactcaaggatagcaacattacctggacgcttctcggacactctgagcgtcgtgtcgtc
ctccaagaagatgattcatttgtagcgtctaagaccaaggctgccctcgatggaggaatc
aatgttattttctgctgcggagagtcactcgagcagagagagtctggcaagacaattgag
gttgttactgcacaattgaaggccgttaaggataaggttcaagactggtcaaagatcgtc
attgcatatgagccaatctgggctatcggtaccggaaaggtcgcttccacggaacaagca
caagaggtacacgccgctattcgctcctggttgaagaaggaggttagcgagaaggccgca
gaagagacaagaatcatctatggtggcagtgtcagtgagaagaactgcaaggatttgagc
aagcaagaagatattgatggtttcttggttggaggtgcttcattgaagccagctttcgtt
gatatcatcaacagccacctgtaa

DBGET integrated database retrieval system