KEGG   Sclerotinia sclerotiorum: SS1G_11433Help
Entry
SS1G_11433        CDS       T01071                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00010  Glycolysis / Gluconeogenesis
ssl00051  Fructose and mannose metabolism
ssl00562  Inositol phosphate metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
ssl01230  Biosynthesis of amino acids
Module
ssl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssl_M00002  Glycolysis, core module involving three-carbon compounds
ssl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS1G_11433
   00051 Fructose and mannose metabolism
    SS1G_11433
   00562 Inositol phosphate metabolism
    SS1G_11433
Enzymes [BR:ssl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SS1G_11433
Exosome [BR:ssl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SS1G_11433
  Exosomal proteins of bladder cancer cells
   SS1G_11433
  Exosomal proteins of melanoma cells
   SS1G_11433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5483505
NCBI-ProteinID: XP_001587441
UniProt: A7F1G3
Position
Unknown
AA seq 247 aa AA seqDB search
MPRQFFVGGNFKMNGSVESIKKIVGYLNDAKLDPNTEVVIAPPALYLLLTREHLRPGLEV
AAQNVFDKPNGAFTGEISVEQLKDSNITWTLLGHSERRVVLQEDDSFVASKTKAALDGGI
NVIFCCGESLEQRESGKTIEVVTAQLKAVKDKVQDWSKIVIAYEPIWAIGTGKVASTEQA
QEVHAAIRSWLKKEVSEKAAEETRIIYGGSVSEKNCKDLSKQEDIDGFLVGGASLKPAFV
DIINSHL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcaatttttcgttggaggtaacttcaagatgaatggatctgttgaatccatc
aagaagattgttggatacttgaacgatgcaaagttggacccaaataccgaggttgtcatt
gctccacccgctctttaccttctccttacccgcgagcacttgagacccggacttgaggtc
gcagctcaaaacgtttttgataagccaaatggagctttcactggtgaaatctccgttgag
caactcaaggatagcaacattacctggacgcttctcggacactctgagcgtcgtgtcgtc
ctccaagaagatgattcatttgtagcgtctaagaccaaggctgccctcgatggaggaatc
aatgttattttctgctgcggagagtcactcgagcagagagagtctggcaagacaattgag
gttgttactgcacaattgaaggccgttaaggataaggttcaagactggtcaaagatcgtc
attgcatatgagccaatctgggctatcggtaccggaaaggtcgcttccacggaacaagca
caagaggtacacgccgctattcgctcctggttgaagaaggaggttagcgagaaggccgca
gaagagacaagaatcatctatggtggcagtgtcagtgagaagaactgcaaggatttgagc
aagcaagaagatattgatggtttcttggttggaggtgcttcattgaagccagctttcgtt
gatatcatcaacagccacctgtaa

DBGET integrated database retrieval system