KEGG   Sclerotinia sclerotiorum: SS1G_11603Help
Entry
SS1G_11603        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SS1G_11603
   01230 Biosynthesis of amino acids
    SS1G_11603
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS1G_11603
   00030 Pentose phosphate pathway
    SS1G_11603
   00051 Fructose and mannose metabolism
    SS1G_11603
   00052 Galactose metabolism
    SS1G_11603
  Energy metabolism
   00680 Methane metabolism
    SS1G_11603
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SS1G_11603
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SS1G_11603
Protein phosphatases and associated proteins [BR:ssl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SS1G_11603
Messenger RNA biogenesis [BR:ssl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SS1G_11603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 791 aa AA seqDB search
MAPQPPPPLEGKKRRIAIMTSGGDSPGMNGVVRACVRMAIYKGCEPYCIYEGYEGLVQGG
KLIQKMGWEDVRGWQSEGGTLIGTARCMAFYERPGRLQAAKNMVLNGIDALIICGGDGSL
TGADKFRAEWPGLIKELIEKKELSEEQVAPFKHLNIVGLVGSIDNDMSGTDATIGCFSAL
GKICEMVDYIEQTASSHSRAFVIEVMGRHCGWLALMAGVATGADFVFIPEKPRADNWKEE
MCKIIQKHRQLGKRKTIVIVAEGAHDQGGNKISPDMIKDLLADKNGLALDTRISTLGHVQ
RGGSACAYDRYLSTLQGIEAVNAVLEATPETVTPFIAINENKITRKPLVQSVIDTQEVAK
AIEARDFDRAMALRDAEFSDFHDSYMTTTATDLNNDMRLPDKKHMRIAIVHVGAPAGGVN
AATRAAVAYCLTRGHTPIAIHNGFAGFARHHQDNPGSVREFDWLEVDGWASKGGSEIGMN
RELPSESGMPLIASLFEKFKIDGLLIIGGFEGFHALSELRQAREKYSSLCIPMTLLPATI
SNNVPGTEYSIGTDTCLNELVRYCDTIKQSASASRRRVFVIETQGGRCGYVATMAGLAVG
ASAVYTPEEGVSIAMLSADIAHLREVFEQDRGQTRAGRLILINEKASKVYHAKLIADMIR
EEAGERFESRDSIPGHVQQGGTPSPMDRTRAVRLAIKCIEHLEKYEAKTDKEIIADKQSS
TVIGIKGAQVVFSNMADVEENETDWPNRRPKDEFWSGVKGAVDILAGRPDVPRPVRRLVG
WKAKDVKRGLM
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcaacccccaccacccctcgaagggaagaaacgacgcatcgccatcatgacc
agtggaggtgattctcctggtatgaatggtgttgtgcgagcttgcgttcgaatggcaatt
tacaaaggatgtgaaccatattgtatctatgaaggatatgaaggtttagtccaaggagga
aaattgatacaaaagatgggctgggaagatgttcgtggatggcaatcagaaggaggtact
cttattggtactgccagatgtatggctttctacgaacgacctggcagattacaagctgca
aaaaatatggtgttgaatggtatcgatgctctcatcatctgtggtggagatggttcctta
actggagcggacaaattcagagcggagtggcccggcttgatcaaggaattgattgagaag
aaggagttatctgaagaacaagttgctccattcaaacacctcaatatcgttggattggtt
ggttcaattgataatgacatgtccggtaccgatgctacaattggttgcttttcagctctt
ggcaaaatttgtgagatggtggattacattgaacaaaccgcttcatcacattcaagagct
ttcgttattgaagttatgggtagacattgtggttggttggccttgatggcaggtgttgct
actggtgcagatttcgttttcatcccagaaaagccaagagcagataactggaaagaagag
atgtgtaagatcattcaaaagcatagacaattgggaaagagaaagacaattgttattgtt
gctgaaggtgctcatgatcagggagggaataaaatctctcccgacatgatcaaagatctt
ctcgcagataagaacggacttgctctcgatactcgtatctctacattaggtcatgttcaa
cgtggtggttctgcatgtgcttatgatcgatacctttctactttacaaggtattgaggca
gtaaatgctgttcttgaagctacaccagaaacagtaactccattcatcgccattaacgag
aacaaaattacgagaaaaccacttgttcaatcggttattgatactcaagaagtagcaaaa
gctattgaagcgagagattttgatagagctatggcattgagagatgcagaattctccgat
ttccatgattcttacatgactaccacagctactgatcttaataatgacatgcgtctccct
gataagaagcacatgagaattgctatcgtacatgttggagctccagctggtggtgttaat
gctgctacacgtgcagcggttgcttactgcttaactcgtggacatacaccaattgctatt
cacaacggattcgctggattcgctcgtcatcatcaagataatccaggatccgttagggaa
tttgattggttagaagttgatggatgggctagtaagggtggttcagaaattggtatgaat
cgtgaacttccatcagaatctggaatgccattgatcgcatcactttttgaaaaattcaag
attgatggtcttctcatcattggaggtttcgaaggtttccacgcattatccgaacttcgt
caagcaagagaaaaatactcttctctttgcatccccatgactttacttccagcaactatt
tccaacaacgttccaggaacagaatactcaattggtactgatacttgtttgaatgaactt
gttcgttattgcgataccatcaaacaatcagcttcagcttctcgtcgtcgtgtttttgtt
attgaaactcaaggtggtcgatgtggttacgtcgctacaatggctggtcttgctgttggt
gcatcagctgtttatactcctgaagaaggtgttagtattgctatgctctcagcagatatc
gcacatcttagagaagttttcgaacaagacagaggtcaaacaagagctggtcgtctaatt
ctcatcaacgaaaaggcatcaaaggtttatcacgctaaactcattgctgacatgatccgc
gaagaagccggtgagcgttttgaatccagagatagcatcccaggtcacgttcaacaaggt
ggtactccatccccaatggatcgtacccgagctgttcgcttagctatcaaatgtattgaa
catctcgaaaaatacgaagctaaaacagacaaagaaattatcgcggataaacaaagttct
acggttattggtattaagggtgcacaagtagtcttctctaatatggctgacgtagaggag
aatgaaacggattggcctaatcgaagaccaaaggatgaattttggtctggagttaaggga
gcagtggacattcttgctggtagacctgatgtaccaagaccggtaagaaggttggtaggt
tggaaagcgaaggatgttaagagaggtttgatgtga

DBGET integrated database retrieval system