KEGG   Sclerotinia sclerotiorum: SS1G_11603Help
Entry
SS1G_11603        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00010  Glycolysis / Gluconeogenesis
ssl00030  Pentose phosphate pathway
ssl00051  Fructose and mannose metabolism
ssl00052  Galactose metabolism
ssl00680  Methane metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
ssl01230  Biosynthesis of amino acids
ssl03018  RNA degradation
Module
ssl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS1G_11603
   00030 Pentose phosphate pathway
    SS1G_11603
   00051 Fructose and mannose metabolism
    SS1G_11603
   00052 Galactose metabolism
    SS1G_11603
  Energy metabolism
   00680 Methane metabolism
    SS1G_11603
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SS1G_11603
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SS1G_11603
Protein phosphatases and associated proteins [BR:ssl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SS1G_11603
Messenger RNA biogenesis [BR:ssl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SS1G_11603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK TgMIC1
Motif
Other DBs
NCBI-GeneID: 5483528
NCBI-ProteinID: XP_001587610
UniProt: A7F1Y2 A0A1D9Q9Q5
Position
Unknown
AA seq 791 aa AA seqDB search
MAPQPPPPLEGKKRRIAIMTSGGDSPGMNGVVRACVRMAIYKGCEPYCIYEGYEGLVQGG
KLIQKMGWEDVRGWQSEGGTLIGTARCMAFYERPGRLQAAKNMVLNGIDALIICGGDGSL
TGADKFRAEWPGLIKELIEKKELSEEQVAPFKHLNIVGLVGSIDNDMSGTDATIGCFSAL
GKICEMVDYIEQTASSHSRAFVIEVMGRHCGWLALMAGVATGADFVFIPEKPRADNWKEE
MCKIIQKHRQLGKRKTIVIVAEGAHDQGGNKISPDMIKDLLADKNGLALDTRISTLGHVQ
RGGSACAYDRYLSTLQGIEAVNAVLEATPETVTPFIAINENKITRKPLVQSVIDTQEVAK
AIEARDFDRAMALRDAEFSDFHDSYMTTTATDLNNDMRLPDKKHMRIAIVHVGAPAGGVN
AATRAAVAYCLTRGHTPIAIHNGFAGFARHHQDNPGSVREFDWLEVDGWASKGGSEIGMN
RELPSESGMPLIASLFEKFKIDGLLIIGGFEGFHALSELRQAREKYSSLCIPMTLLPATI
SNNVPGTEYSIGTDTCLNELVRYCDTIKQSASASRRRVFVIETQGGRCGYVATMAGLAVG
ASAVYTPEEGVSIAMLSADIAHLREVFEQDRGQTRAGRLILINEKASKVYHAKLIADMIR
EEAGERFESRDSIPGHVQQGGTPSPMDRTRAVRLAIKCIEHLEKYEAKTDKEIIADKQSS
TVIGIKGAQVVFSNMADVEENETDWPNRRPKDEFWSGVKGAVDILAGRPDVPRPVRRLVG
WKAKDVKRGLM
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcaacccccaccacccctcgaagggaagaaacgacgcatcgccatcatgacc
agtggaggtgattctcctggtatgaatggtgttgtgcgagcttgcgttcgaatggcaatt
tacaaaggatgtgaaccatattgtatctatgaaggatatgaaggtttagtccaaggagga
aaattgatacaaaagatgggctgggaagatgttcgtggatggcaatcagaaggaggtact
cttattggtactgccagatgtatggctttctacgaacgacctggcagattacaagctgca
aaaaatatggtgttgaatggtatcgatgctctcatcatctgtggtggagatggttcctta
actggagcggacaaattcagagcggagtggcccggcttgatcaaggaattgattgagaag
aaggagttatctgaagaacaagttgctccattcaaacacctcaatatcgttggattggtt
ggttcaattgataatgacatgtccggtaccgatgctacaattggttgcttttcagctctt
ggcaaaatttgtgagatggtggattacattgaacaaaccgcttcatcacattcaagagct
ttcgttattgaagttatgggtagacattgtggttggttggccttgatggcaggtgttgct
actggtgcagatttcgttttcatcccagaaaagccaagagcagataactggaaagaagag
atgtgtaagatcattcaaaagcatagacaattgggaaagagaaagacaattgttattgtt
gctgaaggtgctcatgatcagggagggaataaaatctctcccgacatgatcaaagatctt
ctcgcagataagaacggacttgctctcgatactcgtatctctacattaggtcatgttcaa
cgtggtggttctgcatgtgcttatgatcgatacctttctactttacaaggtattgaggca
gtaaatgctgttcttgaagctacaccagaaacagtaactccattcatcgccattaacgag
aacaaaattacgagaaaaccacttgttcaatcggttattgatactcaagaagtagcaaaa
gctattgaagcgagagattttgatagagctatggcattgagagatgcagaattctccgat
ttccatgattcttacatgactaccacagctactgatcttaataatgacatgcgtctccct
gataagaagcacatgagaattgctatcgtacatgttggagctccagctggtggtgttaat
gctgctacacgtgcagcggttgcttactgcttaactcgtggacatacaccaattgctatt
cacaacggattcgctggattcgctcgtcatcatcaagataatccaggatccgttagggaa
tttgattggttagaagttgatggatgggctagtaagggtggttcagaaattggtatgaat
cgtgaacttccatcagaatctggaatgccattgatcgcatcactttttgaaaaattcaag
attgatggtcttctcatcattggaggtttcgaaggtttccacgcattatccgaacttcgt
caagcaagagaaaaatactcttctctttgcatccccatgactttacttccagcaactatt
tccaacaacgttccaggaacagaatactcaattggtactgatacttgtttgaatgaactt
gttcgttattgcgataccatcaaacaatcagcttcagcttctcgtcgtcgtgtttttgtt
attgaaactcaaggtggtcgatgtggttacgtcgctacaatggctggtcttgctgttggt
gcatcagctgtttatactcctgaagaaggtgttagtattgctatgctctcagcagatatc
gcacatcttagagaagttttcgaacaagacagaggtcaaacaagagctggtcgtctaatt
ctcatcaacgaaaaggcatcaaaggtttatcacgctaaactcattgctgacatgatccgc
gaagaagccggtgagcgttttgaatccagagatagcatcccaggtcacgttcaacaaggt
ggtactccatccccaatggatcgtacccgagctgttcgcttagctatcaaatgtattgaa
catctcgaaaaatacgaagctaaaacagacaaagaaattatcgcggataaacaaagttct
acggttattggtattaagggtgcacaagtagtcttctctaatatggctgacgtagaggag
aatgaaacggattggcctaatcgaagaccaaaggatgaattttggtctggagttaaggga
gcagtggacattcttgctggtagacctgatgtaccaagaccggtaagaaggttggtaggt
tggaaagcgaaggatgttaagagaggtttgatgtga

DBGET integrated database retrieval system