KEGG   Sclerotinia sclerotiorum: SS1G_11697Help
Entry
SS1G_11697        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SS1G_11697
  Amino acid metabolism
   00380 Tryptophan metabolism
    SS1G_11697
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SS1G_11697
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SS1G_11697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 954 aa AA seqDB search
MAALEEIPGPPGLPFLGNVQDVNPISPLASIERLAGIYGSIFKLNIGGSEKLWISSQALL
NEVCDEKRFTKIVSGSLEEVRHGVGDGLFTANYGEENWGLAHRVLMPDDFTRLALDSIAL
CAMGTRFNSFYREEMHPFVGAMSGFLVESGARAQRPAIANYFMRSAQAKFDSDIALLQSV
AKELLAERRANPNDKKDLLNAMINGRDPKTGKGLSDSNILNNMITFLIAGHETTSGMLSF
LFYYLLKNPSAYQAAQREVDGVVGKGPITIDHLSKLPYIEACLRETLRLNPPAPVISFYP
LPDSTESPIIIGGKYEVKPGQSILALIPEIHRDPTVYGDDADLFKPERMLDEPFRNLPPN
AWKPFGNGMRGCIGRPFAWQEALLAVAMLLQNLNFRMDDPSYNLLIKQTLSIKPNGFYMR
ASLRDGIDSLDLEKMLHVDTSKERLSENDQKLSKDLSSSGKPKQPMSIFYGSSSGTCEAL
ARNLAREASGRGYEARVDPLDAAVDKIPKGQPVILISSSYEGQAPDNARHFVEWLENLKG
SDRLKDIKYAVYGCGNHDWVATYQRIPKLLDTEFENNGATRIADTGVGDVAAGDIFEAFD
KWQDSCLWTQLASSAVPEEDVGLEIDIDSSARSSRLRQDVRESIVLSNKVLTAPGVPEKR
HISLKLPTAASTPEPEVREKIEYLGKEGFNQEVFLKRRSPLDILEEYPSAALSLGDFLAM
LPPMRIRQYSISSSPFHDPTVATLTWSVLDAVSKAGESKRYLGVASNYLSSVEEGDRVHV
SVRPSRGSFHPPTDLENTPVIYICAGTGLAPFRGFVQERALQIAAGRKLAAAYLFIGCGH
PDKDSLFSEELKKWEADGVVKLHYAFSQSPEISKGCRHVQDRLWEEREELRNVFQSGAKL
YVCGSSMVGEGVSVMTKKIYAEAADLLGKTKTDEEVEDWFQSIKNDRFASDVFT
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggcagctttggaagagatacctgggcctcctggacttccttttttagggaacgtccaa
gatgttaaccccatcagtccacttgctagtattgagcgtttggcaggaatatatggttcc
atcttcaagcttaatatcggcggttctgaaaaattgtggatatcctcgcaagcactcctc
aatgaggtctgcgacgagaagaggttcacgaagatagtatctggcagcttagaggaagtt
cgacacggtgtcggcgacggccttttcacagccaactatggcgaagaaaattggggattg
gcacatagagtattaatgccagatgacttcacgagattggcactggactctattgctttg
tgcgctatgggtacccgtttcaatagcttctaccgtgaagaaatgcatcccttcgtcggc
gccatgagtggattccttgtcgaatctggtgctagagctcagcgacctgctatcgccaat
tattttatgcgttctgcacaagccaagttcgattctgatatcgcgctgcttcaaagtgtg
gccaaagaactgttggctgagcgacgggcgaatcccaatgataagaaagatctgcttaat
gccatgatcaacggcagagatccaaaaactggaaaaggcctctcagattcgaatattttg
aacaatatgattacctttctcattgctggtcatgaaacgacgagtggaatgctctctttc
cttttctattatttactaaagaatccttcagcataccaggcagctcaacgcgaggttgat
ggagttgttggcaagggacccataaccattgatcacctttcaaaactcccatacatagaa
gcttgcctgcgagagacactgaggttgaatcctccagcccccgttatctccttctatccc
ctgcctgattcaaccgagtcgcccataatcatcggtggtaagtacgaagtgaagccagga
cagtcaatacttgctctcatccctgaaattcaccgtgatcccactgtctacggtgacgat
gccgacttattcaaaccagaacgaatgttggacgagcctttcagaaacttaccacccaac
gcctggaaaccgttcggcaatggtatgagagggtgtatcgggagaccttttgcatggcag
gaggcacttctggccgtcgctatgctcttacaaaacctcaatttcagaatggatgatcca
agttacaatcttctcatcaaacaaacattgagtatcaagccaaacgggttttatatgcgc
gcgagcctccgggatggcattgattctcttgacctcgaaaaaatgctgcacgttgatact
tccaaagagcgactgtcagagaacgatcaaaaacttagcaaggatttgagcagctcggga
aagccaaagcaaccgatgtctattttttatggttcgagctcaggaacatgtgaagctttg
gctcgaaatcttgcaagagaagctagtggacgtggctacgaggctcgagttgaccctctt
gatgctgctgtagacaaaattccgaaaggccagccagtaatcttgatatcgtcaagttat
gaagggcaagctcctgataatgctcgccatttcgttgagtggctggaaaatctaaaaggc
agtgatcgccttaaggacattaaatatgctgtttatggttgcggaaatcatgattgggta
gctacttatcagcgaattccgaaattgctcgacaccgaattcgagaataacggcgcaaca
agaatcgcagatactggggtaggtgacgttgctgctggagatatcttcgaagcttttgac
aaatggcaagatagttgtctttggactcaattagctagcagtgcggttcctgaagaagat
gtaggattggagatcgacatcgattctagtgcccggtcctccaggcttcgacaagacgta
cgcgaatcaattgttttaagcaacaaggttttgaccgcaccgggagtgccggagaagcgt
cacatatcactcaaattgccgacagccgcaagtacacctgaaccagaagtaagagaaaag
atcgagtatttgggtaaggaaggcttcaaccaagaagttttcctcaaacgtcgttcgcca
ttggatatcctcgaagaatatccatccgccgcattatctctgggagacttcctagcaatg
cttccacccatgagaatacgtcagtactctatctcttcatcgccgtttcatgaccctaca
gtcgccaccctgacctggtctgttctcgacgctgtctcaaaagccggtgagtcgaagcgt
tatttgggggtagcatcgaactacctttcttctgttgaagagggagatcgtgtgcatgtc
tctgtcagaccaagtcgtggatctttccatccacccacggatttggagaatactccggta
atctatatttgcgccgggactggattagcccctttccgtggttttgtacaagagcgagca
ttgcaaatcgcagctggacgaaaactagccgctgcatatttgttcattggctgtggacat
cccgataaagactctttgttctccgaggagctaaagaaatgggaagcggatggagtagta
aagctgcattacgccttctcgcaatctccagaaataagtaaaggatgccgccatgttcag
gatagactttgggaagaaagagaagagttaaggaacgtttttcaaagtggtgcaaagttg
tatgtgtgtggatcaagtatggttggtgaaggcgtctcggtcatgactaaaaagatttac
gcagaggctgctgatcttcttgggaagactaagacggacgaggaggttgaggattggttt
cagagcatcaagaatgataggtttgctagtgatgtcttcacttga

DBGET integrated database retrieval system