KEGG   Sclerotinia sclerotiorum: SS1G_11697Help
Entry
SS1G_11697        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ssl00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ssl00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 954 aa AA seqDB search
MAALEEIPGPPGLPFLGNVQDVNPISPLASIERLAGIYGSIFKLNIGGSEKLWISSQALL
NEVCDEKRFTKIVSGSLEEVRHGVGDGLFTANYGEENWGLAHRVLMPDDFTRLALDSIAL
CAMGTRFNSFYREEMHPFVGAMSGFLVESGARAQRPAIANYFMRSAQAKFDSDIALLQSV
AKELLAERRANPNDKKDLLNAMINGRDPKTGKGLSDSNILNNMITFLIAGHETTSGMLSF
LFYYLLKNPSAYQAAQREVDGVVGKGPITIDHLSKLPYIEACLRETLRLNPPAPVISFYP
LPDSTESPIIIGGKYEVKPGQSILALIPEIHRDPTVYGDDADLFKPERMLDEPFRNLPPN
AWKPFGNGMRGCIGRPFAWQEALLAVAMLLQNLNFRMDDPSYNLLIKQTLSIKPNGFYMR
ASLRDGIDSLDLEKMLHVDTSKERLSENDQKLSKDLSSSGKPKQPMSIFYGSSSGTCEAL
ARNLAREASGRGYEARVDPLDAAVDKIPKGQPVILISSSYEGQAPDNARHFVEWLENLKG
SDRLKDIKYAVYGCGNHDWVATYQRIPKLLDTEFENNGATRIADTGVGDVAAGDIFEAFD
KWQDSCLWTQLASSAVPEEDVGLEIDIDSSARSSRLRQDVRESIVLSNKVLTAPGVPEKR
HISLKLPTAASTPEPEVREKIEYLGKEGFNQEVFLKRRSPLDILEEYPSAALSLGDFLAM
LPPMRIRQYSISSSPFHDPTVATLTWSVLDAVSKAGESKRYLGVASNYLSSVEEGDRVHV
SVRPSRGSFHPPTDLENTPVIYICAGTGLAPFRGFVQERALQIAAGRKLAAAYLFIGCGH
PDKDSLFSEELKKWEADGVVKLHYAFSQSPEISKGCRHVQDRLWEEREELRNVFQSGAKL
YVCGSSMVGEGVSVMTKKIYAEAADLLGKTKTDEEVEDWFQSIKNDRFASDVFT
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggcagctttggaagagatacctgggcctcctggacttccttttttagggaacgtccaa
gatgttaaccccatcagtccacttgctagtattgagcgtttggcaggaatatatggttcc
atcttcaagcttaatatcggcggttctgaaaaattgtggatatcctcgcaagcactcctc
aatgaggtctgcgacgagaagaggttcacgaagatagtatctggcagcttagaggaagtt
cgacacggtgtcggcgacggccttttcacagccaactatggcgaagaaaattggggattg
gcacatagagtattaatgccagatgacttcacgagattggcactggactctattgctttg
tgcgctatgggtacccgtttcaatagcttctaccgtgaagaaatgcatcccttcgtcggc
gccatgagtggattccttgtcgaatctggtgctagagctcagcgacctgctatcgccaat
tattttatgcgttctgcacaagccaagttcgattctgatatcgcgctgcttcaaagtgtg
gccaaagaactgttggctgagcgacgggcgaatcccaatgataagaaagatctgcttaat
gccatgatcaacggcagagatccaaaaactggaaaaggcctctcagattcgaatattttg
aacaatatgattacctttctcattgctggtcatgaaacgacgagtggaatgctctctttc
cttttctattatttactaaagaatccttcagcataccaggcagctcaacgcgaggttgat
ggagttgttggcaagggacccataaccattgatcacctttcaaaactcccatacatagaa
gcttgcctgcgagagacactgaggttgaatcctccagcccccgttatctccttctatccc
ctgcctgattcaaccgagtcgcccataatcatcggtggtaagtacgaagtgaagccagga
cagtcaatacttgctctcatccctgaaattcaccgtgatcccactgtctacggtgacgat
gccgacttattcaaaccagaacgaatgttggacgagcctttcagaaacttaccacccaac
gcctggaaaccgttcggcaatggtatgagagggtgtatcgggagaccttttgcatggcag
gaggcacttctggccgtcgctatgctcttacaaaacctcaatttcagaatggatgatcca
agttacaatcttctcatcaaacaaacattgagtatcaagccaaacgggttttatatgcgc
gcgagcctccgggatggcattgattctcttgacctcgaaaaaatgctgcacgttgatact
tccaaagagcgactgtcagagaacgatcaaaaacttagcaaggatttgagcagctcggga
aagccaaagcaaccgatgtctattttttatggttcgagctcaggaacatgtgaagctttg
gctcgaaatcttgcaagagaagctagtggacgtggctacgaggctcgagttgaccctctt
gatgctgctgtagacaaaattccgaaaggccagccagtaatcttgatatcgtcaagttat
gaagggcaagctcctgataatgctcgccatttcgttgagtggctggaaaatctaaaaggc
agtgatcgccttaaggacattaaatatgctgtttatggttgcggaaatcatgattgggta
gctacttatcagcgaattccgaaattgctcgacaccgaattcgagaataacggcgcaaca
agaatcgcagatactggggtaggtgacgttgctgctggagatatcttcgaagcttttgac
aaatggcaagatagttgtctttggactcaattagctagcagtgcggttcctgaagaagat
gtaggattggagatcgacatcgattctagtgcccggtcctccaggcttcgacaagacgta
cgcgaatcaattgttttaagcaacaaggttttgaccgcaccgggagtgccggagaagcgt
cacatatcactcaaattgccgacagccgcaagtacacctgaaccagaagtaagagaaaag
atcgagtatttgggtaaggaaggcttcaaccaagaagttttcctcaaacgtcgttcgcca
ttggatatcctcgaagaatatccatccgccgcattatctctgggagacttcctagcaatg
cttccacccatgagaatacgtcagtactctatctcttcatcgccgtttcatgaccctaca
gtcgccaccctgacctggtctgttctcgacgctgtctcaaaagccggtgagtcgaagcgt
tatttgggggtagcatcgaactacctttcttctgttgaagagggagatcgtgtgcatgtc
tctgtcagaccaagtcgtggatctttccatccacccacggatttggagaatactccggta
atctatatttgcgccgggactggattagcccctttccgtggttttgtacaagagcgagca
ttgcaaatcgcagctggacgaaaactagccgctgcatatttgttcattggctgtggacat
cccgataaagactctttgttctccgaggagctaaagaaatgggaagcggatggagtagta
aagctgcattacgccttctcgcaatctccagaaataagtaaaggatgccgccatgttcag
gatagactttgggaagaaagagaagagttaaggaacgtttttcaaagtggtgcaaagttg
tatgtgtgtggatcaagtatggttggtgaaggcgtctcggtcatgactaaaaagatttac
gcagaggctgctgatcttcttgggaagactaagacggacgaggaggttgaggattggttt
cagagcatcaagaatgataggtttgctagtgatgtcttcacttga

DBGET integrated database retrieval system