KEGG   Sclerotinia sclerotiorum: SS1G_11866Help
Entry
SS1G_11866        CDS       T01071                                 

Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SS1G_11866
Protein kinases [BR:ssl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   SS1G_11866
Exosome [BR:ssl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SS1G_11866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 355 aa AA seqDB search
MASRAPNPSSGSRKISFNVSEQYDIQDVVGEGAYGVVCSALHKPSGQKVAIKKITPFDHS
MFCLRTLREMKLLRYFNHENIISILDIQKPRNYESFTEVYLIQELMETDMHRVIRTQDLS
DDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSG
FMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILD
VLGTPTMEDYYGIKSRRAREYIRSLPFKKKVPFKTMFPKTSDLALDLLEKLLAFNPVKRI
TVEEALKHPYLEPYHDPEDEPTANPIPEEFFDFDKNKDNLTKEQLKQLIYEEIMR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtcgtgcgcctaatccctcttcgggatcacgaaagatctcctttaatgtcagc
gaacaatatgatattcaggatgttgtaggagagggagcttatggtgttgtttgttcagct
ttgcacaagccttcagggcaaaaggtcgctatcaagaagatcactccatttgatcattcg
atgttctgtctgcgaacactacgtgagatgaagttacttcggtacttcaatcatgagaac
atcatctccattctcgatattcaaaagcctagaaattacgagtccttcaccgaagtttat
ctcattcaagaactcatggaaaccgatatgcatcgtgtaattcgtactcaagatctatcc
gatgatcattgccagtacttcatctatcaaactctccgagccttgaaagctatgcattca
gcaaacgttttacacagagatttgaaaccatccaatctgttacttaatgccaactgcgat
ttgaaggtctgcgattttggtcttgctagatccgctgcgtcccaagaagataactctggt
ttcatgaccgaatatgttgcgaccagatggtaccgtgccccagaaattatgttgacgttc
aaagagtataccaaggccattgatgtatggtctgttgggtgtatcttggccgagatgtta
agcggaaagcccctattccctggaaaggattatcaccaccaactcacactcattcttgat
gttcttggtactcctaccatggaagattactacggcatcaaatctcgtcgtgcaagagaa
tatatccgatcgttgccattcaagaagaaggtcccattcaagaccatgttcccaaaaacc
tcagatctcgctctggatctcctcgagaaacttctcgcatttaatcctgtcaagagaatt
actgtcgaggaagcactgaaacatccatatcttgaaccataccatgacccagaggatgaa
cctaccgccaaccctatcccggaagaattctttgatttcgataaaaacaaggacaacctc
accaaggaacaactcaaacaattgatctacgaggagatcatgcgatag

DBGET integrated database retrieval system