KEGG   Sclerotinia sclerotiorum: SS1G_12347Help
Entry
SS1G_12347        CDS       T01071                                 

Definition
anthranilate synthase
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SS1G_12347
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SS1G_12347
Enzymes [BR:ssl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SS1G_12347
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SS1G_12347
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SS1G_12347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 764 aa AA seqDB search
MPSADLIDYSPHQPEPAPPLPSASNVILIDNFDSFSWNVYQYLVLEGATVTVYRNDELSV
EDLIALNPTQLVISPGPGHPKTDSGVSRDAIKYFAGKIPVFGVCMGQQCILDVYGGEVIF
AGEILHGKTSPLRHDSKGLYASLPQDLPVTRYHSLAGTHPTMPECLEVSSWIEADVGGGK
GVIMGIRHKEYVLEAVQFHPESILTAEGRVMLRNFLKMRGGTWVENERLQKEDAESVVPV
SKSVSTSTKKENILDKIFAHRKAAVSAQKEVSSQRPSDLQAAYELDIAPPLVPFVQRLRK
SPFPLSLMAEIKRASPSKGVISLSACAPAQARTYALAGASVISVLTEPEWFKGSIDDLRA
VRQALEGMPNRPAVLRKEFIFEEYQILEARLAGADTVLLIVKMLDEETLTRLYHYSVSLG
MEPLVEVNTPEEMTIAVNLGAKVIGVNNRNLTSFEVDLDTTSRLLNQVPKETIVCALSGI
SGPKDVEAYQKNGVGAVLVGEALMRAKDTALFIRELLGGSSILNKSASGSLLVKICGTRN
PETATEAIKAGADLIGMILVPGRGRHVPYKDAIAISRAVHQAQQTTGTVVGDRVSNQASD
FFANAASNVSSHRPLLVGVFQNQPLEEVLELQKAYDLDIVQLHGEEPLEWANLIPVPVIR
SFKPGQAGLGRRGYHTIPLLDSASGGSGQKLDVTEVQATLTKDQGLRVILAGGLNHENVA
EAVRSVGDVGDRIIGVDVSSGVEENGAQSIERIKAFIKEAKSVR
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgccttccgcagacttaatcgattattctccccaccagcccgagccagctcccccgctt
ccctctgcttcaaatgtgattctgatcgataacttcgactcattctcctggaatgtttac
caatacctcgttcttgaaggtgcaacagtaaccgtctaccgaaacgatgaacttagcgtc
gaggatcttattgccctcaaccctactcaattggtgataagtccaggtccaggtcatcca
aaaacagactctggggttagtagagatgctattaaatacttcgcaggcaagatacctgtg
tttggagtctgcatgggacaacagtgcatattggacgtatatggaggagaggttatattt
gcgggagaaatcttgcacggcaaaacgtcgccactgcgacacgactcgaaaggattatat
gcaagtctaccgcaagacttaccggttacacgatatcattcccttgctggcacacatcca
actatgcccgaatgtctggaggtatcatcctggatcgaggccgacgttggtggaggaaaa
ggtgtaataatgggcattagacataaagaatacgtcttagaagctgtacaattccaccct
gagagtatcttgactgctgaaggccgagtcatgctcaggaacttcttgaagatgcggggt
ggcacctgggtagagaatgaacgtttacaaaaagaggatgcggagagtgtggtgccagtc
tccaagtcggtttctactagtaccaagaaagagaatatattggataaaattttcgcgcat
cgcaaggccgcagtttctgcacaaaaagaagtttcatcccaacgaccctcagatctccaa
gccgcttatgagctcgacatcgctcctcctcttgttccctttgttcaacgtctccgcaaa
tcaccatttccgttgtcactcatggccgaaatcaaacgagcatctccctcaaagggtgtc
atctctttatctgcatgtgctccagctcaagctagaacctatgctctagctggtgcaagt
gtgatttccgttttgacagagcccgagtggttcaagggaagcattgacgatttgcgagct
gtacgacaggctcttgaaggcatgccaaatcggcctgctgttttacggaaagaattcatc
ttcgaagagtaccaaatattagaagctagattagctggtgccgataccgttttacttatc
gtcaagatgctagatgaagaaactttgacacgcttgtatcattattccgtctcgcttgga
atggagccgttagtggaagtaaatacaccagaagaaatgaccatagctgtcaaccttggt
gcaaaagtcattggtgtgaacaaccggaatttgacaagttttgaagtagatcttgatact
acaagtcgtctcctcaaccaagttccgaaagaaactatcgtatgcgctcttagtggtatt
tccggtcccaaagatgtagaagcataccagaagaatggtgtaggtgcagttcttgtgggc
gaggcgctcatgcgagccaaagatacagctcttttcattcgggaactacttggaggttca
agtatcctcaacaaatctgcaagtggtagcttacttgtgaagatttgtggaacaagaaat
cctgagactgcaacagaagctataaaagctggtgcggatttgatcgggatgattcttgtc
cctggtagaggtcgacatgttccgtacaaagatgcaattgctatttctagggctgttcat
caagcacagcagacgactgggacggtcgttggtgaccgagtgagtaaccaagcatcggat
ttcttcgctaatgcagcatcgaatgtttcgagtcatcggcctttgttagtcggcgttttc
caaaaccaacctctagaagaggttttggagctgcagaaggcatatgatttagatatagtg
cagctgcacggtgaggaaccattggaatgggcaaatttaataccagttcctgtcatccga
agcttcaaacctggtcaggctggtctcggaagaagaggttaccataccattcctctgcta
gactcggcatcagggggctctggacaaaaattggacgtgacagaggtacaggctacgttg
acaaaagatcaaggtctcagagtcattcttgctggcggattgaatcacgaaaacgtggca
gaagctgtgcgatcagtgggtgatgtaggtgatcggatcatcggtgtcgacgttagtagc
ggcgtagaggaaaatggcgctcagagtattgagaggatcaaagctttcattaaggaagca
aagagcgttagatag

DBGET integrated database retrieval system