KEGG   Sclerotinia sclerotiorum: SS1G_12550Help
Entry
SS1G_12550        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SS1G_12550
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     SS1G_12550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 938 aa AA seqDB search
MFKPFRPPLLKNAPKSTKPVDDFSNVQVISDSEEEILTKPVAKKRRLLIHDVEEAPKSKA
PITSSAANAPRKPLVVVRNPVEASQGTSSSENTSGIDGYYLVLWRKFTMKKHKTWDGDGV
LAVTGGYARLQNIDGREMGRCMYNEPLLPGSTLSIGGKEVEIDATITKADFLAGRPFLNN
SNKSPVPESNSPGTRPSPHTTLSSISKSNPVSTVGKRKDSGLGSTIPAKSFYASAPKSDA
VKSQFKNPLLATTVMPQNKNGLPTPRHDPSVPGAIVMQRPNPKHLAKGKDVVDVVVDPFL
GRHLRDHQKEGVKFLYECVMGYRSFNGQGAILADEMGLGKTLQTIALLWTLLKQNPEHPN
EGGVIKKALIVCPVTLIANWKAEFNKWLGNERIGVFVADGSKNIRLTDFTHGKSYSVMII
GYEKLRTVQEELKKGGGIDIVVADEGHRLKTAANKSAQAIRNLNTERRVILSGTPIQNDL
SEFFTMVDFVNPGLLNGYNTFKKCFEAPILKSRQPGATENDMEKGTAREEELADLTKLFI
LRRNASILAKYLKPKTEYVLFCKPTQAQAEVYQHVLASPVFGRVLGSSEASLQLITMLKK
VCNAPSLLVKKSDTDTPSNSNVAQLLESIPPEILKKNIVVASILVSNYTSTLDLLMSHLS
SLNLPFLRLDGSTPQAKRQDLVNTFNKTPASKYFAFLLSAKSGGAGINLIGASRLVLFDV
DWNPATDLQAMARIHRDGQKRSVKIYRFLMSGGMDEKIYQRQVTKIGLADSVMDGKKNEA
SFSADELRDLFRLDMNARCQTHELLGCGCEGSGREESIAMASEISVVDKELNASEEDEDD
DDEFPVNPACSLVTATRANVEAQQKIALEATQGKRSKKGKKMQALMEYRHIDTSIFTSPA
NLTPSEVDQVKQSLDDEVLLTVLEDERCKVCFVFAKKG
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaccattccggcctccacttttgaagaatgcgccaaaatctactaagcccgta
gatgatttctccaacgtccaggtcatatcggattctgaagaggaaatcttgaccaaacca
gtggcaaagaagaggcgacttctgatacatgatgtcgaagaagctccaaagagtaaagcc
ccaattacatcttcggctgccaatgcgcctcggaaacctttggttgtcgtaagaaacccc
gttgaagcaagtcaaggcactagttcgtctgaaaatacatccgggatcgacggatattat
ttggtattatggcgcaaattcacgatgaaaaagcacaagacgtgggatggagatggagta
ctagccgttactggaggttacgctcggcttcagaatatcgatggcagggagatggggcgc
tgcatgtataatgagcctctattacccggcagtacattgagtattgggggaaaagaagta
gagattgatgctaccattacaaaggcagattttcttgctggccgaccatttctcaataac
agcaataaatctcctgtaccagagagcaacagtccaggcacacgaccctcgcctcatact
acattatctagtatctcgaaaagtaaccctgtgagcacagttgggaagaggaaagacagt
ggcttaggttcaactatacccgctaaaagcttctatgcatctgccccaaagagcgatgca
gtcaagtctcaatttaagaatcctctactagcaacaactgtcatgccacagaacaagaac
ggtcttccgactccccgtcatgatccttctgtacctggtgcaatcgtcatgcaacgtccc
aatcccaagcaccttgctaaaggaaaggatgttgtggatgttgtcgtggatcctttctta
ggtaggcatttacgcgaccatcaaaaggagggagttaaatttttgtatgagtgtgtcatg
ggttaccgatctttcaatggacagggtgcaattttagctgatgagatgggtctgggaaag
acgctgcagacaattgcgctcttatggacactattgaagcaaaatccggagcatccaaac
gagggaggcgtcataaagaaggctctgatagtctgtccagtcactcttattgcgaactgg
aaagcagaatttaataagtggctcgggaatgagagaataggagtgtttgtcgctgatggc
tctaaaaatattcgactcaccgattttactcatggcaagagttatagcgtcatgatcatt
ggatacgaaaagctacgtacagtacaggaagaactgaagaaaggaggcggaatagatata
gtcgttgctgatgaaggacatcgcctaaaaacagctgcgaacaaatcagcgcaggcaatc
aggaatctgaataccgagaggcgagtaatcctctctggaaccccaatacaaaatgacttg
tcggagttctttacaatggtggactttgtgaatcccggcctcctcaatggctacaatact
ttcaagaaatgttttgaggctccaatcttgaaaagcaggcagccaggtgctacagagaat
gatatggaaaagggaacggcccgagaagaggaattggcagacttgaccaagttgttcatt
ttacgccgcaatgcgagtatactcgccaaatacttaaagccaaagacagaatatgtacta
ttctgcaagcccacgcaggcccaggctgaggtctatcagcatgttcttgcctccccggtc
ttcggcagagtccttggcagctcagaagcatctttacagcttattactatgctcaagaaa
gtctgtaacgccccgagtctcttagtcaagaagagcgacacagatactcctagcaattca
aatgtcgcccaacttcttgaaagcatccctcctgaaatcctgaagaaaaatattgttgtg
gcaagcattcttgtatccaactatacgtctactctcgacctactaatgtctcacctttcg
tcattgaatttgccattcttgcgcctcgatggtagcactcctcaggcaaaacggcaggat
ttggtgaacacattcaacaagacacctgcatctaaatactttgcattcctcctttcagca
aaatctggcggtgctggtattaacttgatcggggcatcgcgcctcgtgttgtttgacgtt
gattggaaccctgcaactgaccttcaagccatggcacgtattcaccgtgatggccagaaa
cgatcagtaaagatatataggtttttgatgtcaggaggcatggatgaaaaaatttatcaa
cgacaagtcaccaagatcggactcgctgacagtgtcatggatggcaaaaagaacgaggcg
agtttctcagccgatgagttacgagatctctttagattagacatgaatgcgcgatgccaa
actcacgaactacttggttgcggctgtgaaggttctggtcgcgaggagtcgattgcaatg
gcctctgaaatctcggtggttgacaaggaactgaacgccagtgaagaagatgaagacgat
gatgacgaatttcctgtaaatccagcatgttcactggtaacagctaccagagcaaatgta
gaagctcagcaaaagattgctttggaagccactcaaggaaaacggtccaagaagggcaag
aagatgcaagctttgatggagtatagacacattgatacttccatattcaccagtccggcg
aacctcactcctagtgaggtcgaccaggtgaaacagtcactagatgatgaagtcttactt
acggttctagaggatgaaagatgtaaagtttgctttgtttttgctaaaaaaggatag

DBGET integrated database retrieval system