KEGG   Sclerotinia sclerotiorum: SS1G_12553Help
Entry
SS1G_12553        CDS       T01071                                 

Definition
serine/threonine protein phosphatase PP1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:ssl03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ssl04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 282 aa AA seqDB search
MAEQDVDLDSIIDRLLEVRGSRPGKQVQLLEQEIRYLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RAIIDEKIFTMHGGLSPDLNSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDR
GVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGA
MMSVDESLLCSFQILKPAEKKQKYVTAGGLGASSRPVTPRKK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaagacgtcgatctcgactctatcattgatagactgctagaagttagaggc
agcagaccaggcaaacaagtacagcttttggaacaagaaattcgttatctctgcaccaag
gctcgcgaaattttcatctctcaacccatcctcttagagcttgaggcaccaatcaagatt
tgtggtgatattcatggacaatattatgatctcctccgtttgtttgaatatggtggattc
cctcccgaggcaaactacctcttccttggtgattatgtcgatagaggcaaacaatctctc
gagactatctgcttgctcttagcatacaagatcaaatatccagaaaacttcttcatcctt
cgcgcgatcatcgatgaaaagatcttcactatgcacggcggtttaagtccagatttgaac
tccatggagcaaatccgtcgtgtcatgcgaccaactgatattcctgattgcggtctcctt
tgcgatctcctctggtccgacccggataaggatatcacaggctggagcgaaaacgatcgt
ggtgtatctttcacattcggtcccgatgtcgtttctaggttcttacaaaagcatgatatg
gatttgatatgcagagctcatcaggtcgtcgaagatggttacgagttcttctcaaagcgg
caattggttacactattcagtgcgcccaattattgcggagagtttgacaatgccggagcc
atgatgagcgtggatgagagtttgctatgttcattccagattttaaaaccagcggagaaa
aaacaaaagtacgtcacagcaggtggtcttggtgcctccagcaggcccgtcactccgagg
aagaaataa

DBGET integrated database retrieval system