KEGG   Sclerotinia sclerotiorum: SS1G_12840Help
Entry
SS1G_12840        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ssl04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1689 aa AA seqDB search
MGPLPIKFTELLQLTSVGVEAQSIGFNSCTLESDSYICVREKKNEAAQPEVVIVDLKQNN
AVTRRPIKADSAIMHWSKQVIALKAQSRTLQIFDLGAKAKLKSATMNEDVVFWKWFSETS
LGLVTDTTVYHWDVFDPNQAAPVEVFKRNPNLSGCQIINYRVSGDGKWMVVVGITQQQGR
VVGAMQLYSKDRGISQAIEGHAAAFGTLRLESAPADTKVFTFSVRTATGAKLHIVEVDHQ
SSNPPFSKKAVDVYFPAEAVNDFPVAMQVSQKYSIIYLVTKYGFIHLYDLETGTCIFMNR
ISSETIFITAGDSESAGLVGVNRRGQVLSVSVDETTIIPYLLQNPANSGLAVKLASRAGL
PGADNLYANQFEQLLAAGNYSEASKIAANSPRGFLRTPQTIERLKSLPAVPGQLSVILQY
FGMLLDKGSLNKHETLELVRPVLAQNRKHLLEKWMKENKLDCSEELGDIVRQQDTQLALA
IYLKANVPHKVVAAFAESGQFEKILPYAQQAGYQPDYVQLLRNIISINPEKGAEFATQLA
NTEGGSLVDIERVVDVFQSQGMVQPATGFLLDALKENKPEQGHLQTRLLEMNLMNAPQVA
DAILGNEMFSHYDKPRIAQLCEQAGLAQRALEHYEDPEAIKRVIVNIVASPTFSQEWLTG
YFGRLSLEQSLDCLDAMLKVNIRQNLGAVVQIAVKYSDLLGPVRLIDLFEKYKTAEGLYH
YLGSIVNLSEDPDVNFKYIEAAVKMQQYQEVERICRDSNSSDPLKVKNFLKEAKLTEQLP
LIIVCDRFNFIHELVLYLYQNQQFQSIEVYVQRVNPARTPAVVGGLLDVDCDEQIIKNLL
NSVNHASIPIDELVQEVESRNRLKLLLPFLEATLAAGNQQQALHNALGKIFIDSNNNPEQ
FLRTNDMYDCKVLGTYAAKRDPSLAIIAFSKGQNDLELVNITNENSMYKAQARYLLERAD
NELWGFVLSENNIHRRSVIDQVISTAVPESTEPEKVSVAVAAFLSADLPGELIELLEKIV
LEPSPFSDNESLQNLLILTATKADKSRVMDYIHKLDAYNPVDVASICIEVGLYEEAFEVY
KKINDHINAVNVLVEHIVSIDRAQDFAEQVEIPEVWSRVAKAQLDGLRVSDGINSYLRAN
DPSNYLEVIEIATHAGKDEDLIKYLRMARKTLREPAIDTGLAFAFARTDQLSELEDFLRG
TNVADIEESGDKAYAEGFHQAAKIFFTSISNWAKLATTLVHLEDYQSAVECARKANNIKV
WKQVNAACVEKKEFRLAQICGLNLIVDAEELQSLVKQYERNGYFDELIALLEQGLGLERC
HMGIFTGLGIALSKYHPDRTMEHLKLFWSRINIPKMIRACEEAHLWPELIFLYCHYDEWD
NAALAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQEQPSLITDLLQALAPRIDV
NRVVKMFEKSDNIPLIKPFLLNVQTQNKKIVNVAINDLLIEEEDYKTLRDSVENYDNYDA
VELAQRLERHDLVFFRQIAANIYRKNKRWEKSIALSKQDKLFKDAIETAAISGKSDVVEE
LLRYFVDIGSRECYVGMLYACYDLIPVHVVMEVSWRHSLTDFTMPFMINYLAQQSSTIAE
LKKDNEERKLREKSQVQEEDNTPILGGNRLMITAGPTGHKSEMSCTVTCTVMAKNANSAL
GELRRCRYV
NT seq 5070 nt NT seq  +upstreamnt  +downstreamnt
atgggtccactcccaatcaagttcacggagcttctccagttaacaagtgtcggagttgag
gcgcaatcgataggttttaattcatgtacactggagtcagattcatacatctgcgtacga
gagaagaagaacgaagccgcgcaaccagaagtcgtcatcgtcgatctaaagcaaaacaat
gctgtcacccgaagacctatcaaggcggatagtgccattatgcactggtcgaaacaggtc
atcgcattaaaggcacaatcaaggaccttacaaatatttgacttgggtgccaaggcgaag
ctaaagtctgctaccatgaatgaagatgttgtcttctggaaatggttcagtgagacaagc
ttgggattggttaccgacacaacagtttaccactgggatgtttttgacccaaatcaggca
gctccggtggaggtcttcaagagaaatccaaacctttctggatgtcagatcatcaactat
cgtgttagtggtgatggcaagtggatggtagtcgtgggcattacacaacaacaaggacga
gtggtcggagcgatgcaactatattcgaaagacagaggcatcagtcaggccatcgagggc
catgccgcagcatttggtacactacgattagaatctgcgccagcagacacgaaagtgttc
acattttcggttcgaactgctactggcgcaaagctacacatagtcgaggtcgaccatcaa
tcttcaaatccaccgttttcaaagaaagcagttgatgtatattttcctgctgaagctgta
aacgatttcccagtcgccatgcaagtttcgcaaaaatacagcattatttatttggttacc
aaatacggctttattcacctatacgatcttgagactggtacatgtattttcatgaaccgc
atctcaagcgagacgatcttcattacagccggcgactcggaatccgctggacttgttggt
gttaaccgaaggggacaagtactgtcggtatctgttgatgaaacaacaattattccgtac
ttgctccaaaatcctgcaaactctggcttagcagtcaagcttgcctcaagagccggtcta
cctggtgcagacaacctctatgccaaccaattcgagcaacttttggctgccggaaactac
tctgaggcttcgaaaatcgcggcaaactctccccgcggctttttgcgaactccacaaact
atcgaacgtctcaagagcttaccggctgtgccgggtcaattatccgttatcttacaatac
tttggtatgctgcttgacaagggatcgttgaataaacatgagacgttagagcttgtacga
cctgttttggctcagaatcgaaagcatcttcttgaaaagtggatgaaggaaaacaaactc
gactgttctgaagaattgggtgacattgtccgacaacaagatacacagcttgcactcgct
atctatcttaaggcaaatgttccccacaaggttgttgctgcattcgccgagagtggtcaa
ttcgagaagatcttaccttacgcccaacaagcaggttaccaaccggactatgtccaatta
ctccgcaatattatctctatcaaccctgaaaagggagccgaatttgctactcagttggca
aatactgaagggggatctctagttgacattgagcgtgttgtagacgtatttcagtctcaa
ggaatggttcaacccgctactggattcttgcttgatgcattaaaggagaacaagcctgag
caaggacacttgcaaactcgcctccttgaaatgaatctcatgaatgcccctcaagtcgct
gacgccattcttggcaacgaaatgttctctcactacgacaagcctagaatcgcgcagcta
tgtgaacaagctggccttgctcaaagagctttggaacactatgaagaccctgaggctatc
aaacgtgtcattgtcaatatcgttgcatccccaactttcagtcaagaatggctcaccggt
tactttggtcgcttgtcccttgaacagtcattagattgtcttgatgctatgcttaaagta
aacattcgtcaaaacctcggggccgttgttcagattgccgtgaaatactcggatttactc
ggccctgttagattgatcgatctttttgagaagtacaagactgctgaaggtctataccac
tatcttggtagcattgtcaatctgagtgaggacccagatgtaaacttcaaatatattgag
gctgccgtgaagatgcagcagtaccaggaggttgaacgtatatgccgtgacagtaattcc
tctgatccgcttaaagtcaaaaacttcttgaaggaggccaaattgaccgagcaattgccg
ctgatcatcgtctgtgatcgattcaacttcattcatgagttggtactttacctctatcag
aaccaacagttccaatctatcgaggtctatgtccaacgagtcaaccctgcacgaactcct
gctgtcgtcggtggattactcgatgttgactgcgatgagcaaatcatcaagaatcttttg
aattccgttaatcatgcttccatccctatcgatgagcttgttcaggaggttgaatcccgc
aaccgtcttaagctcctgttgcctttcctcgaggccaccttggctgcaggcaaccagcaa
caagctttacataacgcgctcggaaaaatctttattgatagtaacaataacccagagcaa
ttcctcaggacaaacgatatgtacgattgcaaggttttgggtacctacgcagctaagcga
gacccgtcgcttgctattatcgcatttagtaaaggtcagaacgatctcgaactcgtcaac
atcaccaacgaaaattctatgtacaaagctcaagctcgctaccttttggaaagagctgat
aacgaattgtgggggtttgtcttgtctgaaaacaatattcaccgccgatctgtgattgat
caagtcatatctacagctgttccagagtcaactgagcccgaaaaggtttctgttgcagtt
gcagccttccttagcgctgatcttccaggtgaattgattgaattgcttgagaagatcgtt
cttgagccttcgccattcagcgacaatgagagcttgcagaatcttctcattctcaccgcc
accaaagctgataagagtcgagtcatggattatattcacaagttggatgcgtataatcct
gtggatgtcgcttcaatctgcattgaagttggcttatatgaggaggcattcgaggtttac
aaaaagattaatgaccatattaacgctgtcaacgtcctcgttgagcacattgtcagcatc
gatcgcgcacaagattttgcggaacaggtggagattcctgaagtatggagtagagtcgct
aaagctcagttggatggtctacgtgtttccgacggtatcaatagctatctccgagcaaac
gatccaagtaactacctagaggttattgaaattgctactcacgctggcaaggacgaagac
ctcatcaaataccttcgcatggcccgtaagacacttcgtgagcctgctatcgacactgga
cttgcctttgcatttgctcgtactgatcaattaagcgaacttgaggacttcctcagggga
actaatgtcgctgatattgaagagtcgggtgacaaggcatatgctgaagggttccaccaa
gctgcgaagatcttcttcaccagtatttcaaactgggccaaacttgccaccactcttgtt
cacctcgaggattatcaatccgccgtcgaatgcgcaagaaaggctaataatatcaaggtc
tggaagcaagtcaacgccgcttgtgttgagaagaaggaattccgtcttgctcagatttgt
ggtctcaatttgatcgttgatgctgaagagttacaaagcttggtcaagcaatacgagcgc
aacggctacttcgatgaacttattgcattacttgagcagggtctaggtcttgaacgatgt
catatgggaatttttacgggactaggtattgctctttccaagtaccatccagatcgcaca
atggagcacctgaagcttttctggagtagaatcaatattccaaagatgattcgtgcctgc
gaggaagcccacctttggccggaattgattttcttgtactgccattatgatgagtgggat
aacgctgctcttgcaatgatggagagagctgccgacgcatgggagcaccactctttcaag
gatatcattgtcaaggtagcaaatttggagatctactaccgcgctctgaatttctatctt
caagagcaaccatctctcattaccgatcttctacaggcacttgcaccaagaattgacgtc
aatcgtgttgtcaagatgttcgaaaagtctgacaacatccctctcatcaagcctttcctt
cttaacgttcaaactcagaataagaagattgtcaacgtggccatcaatgatttgttgatt
gaggaggaagactacaagactctccgtgattctgttgagaactacgataactatgatgcc
gtcgagcttgctcaacgattggagcgtcatgatttggtcttcttccgccaaattgctgct
aatatttaccgcaagaacaaacgctgggagaagtcgatcgctctttcaaagcaagacaag
cttttcaaagatgcaattgagactgctgctatctctggcaagtcagatgttgtcgaggag
ctgcttagatatttcgtcgatatcggtagccgagaatgttatgttggtatgctctatgct
tgctatgatctcatccccgtccatgttgtcatggaagtctcatggcgtcacagccttaca
gattttaccatgccattcatgattaactatttggcccaacaaagctctacgattgctgag
ttaaagaaggacaatgaggagaggaagttgagagaaaagtcacaggttcaagaagaggac
aatacccccattctcggaggcaatcgtcttatgatcaccgctggaccgaccggacataag
agtgagatgtcctgcactgtgacctgcactgtgatggccaagaatgccaattctgcactt
ggcgagttgaggcgatgtagatatgtgtag

DBGET integrated database retrieval system