KEGG   Sclerotinia sclerotiorum: SS1G_12928Help
Entry
SS1G_12928        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SS1G_12928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 372 aa AA seqDB search
MASTTRTFARAGAAFKSTPFRSATRTNAFSAPRQAFRQQSRRGYASQGPAKSSFPLSVGV
AALAIAGGAGYYFVSQGNGSLLSGSAKETAGLITPKFEDYQKVYNEIAARLEEKDDYDDG
SYGPVLVRLAWHASGTFDKATGTGGSNGATMRFAPEGDHGANAGLVAARDFLQPVKAKFP
WISYSDLWILAGICAIQEMQGPTIPFRPGRQDKEAAACTPDGRLPDASQGNKHLRDIFGR
MGFNDQEIVALSGAHALGRCHTDRSGFEGPWTFSPTVVTNEYYKLLLNEKWNWKKWNGPK
QYEDKTTKTLMMLPTDMALVSDKTFRSYVEKYAADESLFMKDFANVITKLFELGVPFAET
TEQGPMKFKPTA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcatctactactcgaaccttcgctagggcaggcgctgcattcaagtcaacacctttc
agatccgccactcgtaccaatgcattcagtgctcctcgtcaagcattccgtcaacaatcc
cgtcgtggatatgcttctcaaggacctgccaaatcttccttccctctctccgttggggtt
gctgctttggccattgctggaggtgctggatactactttgtatctcaaggaaatggatca
ctcttgagtggttctgctaaagaaactgccggtctcatcactcctaagtttgaagattat
caaaaggtttataatgagattgccgcgagattggaggagaaagatgattatgatgatggt
tcttatggacctgtcttagtcagattagcgtggcatgcaagtggaactttcgataaggca
actggtactggtggtagcaatggtgcgactatgagatttgcccctgagggtgatcatggt
gccaatgctggtttggttgctgccagagacttcttgcaacctgttaaggcaaagttccca
tggatctcctactctgacctctggatcctggctggtatttgcgctatccaggaaatgcaa
ggtccaaccattcctttccgaccaggtagacaagataaggaagctgcagcttgcacacct
gatggacgtctcccagatgcttctcaaggtaacaaacatttgagagatatctttggtcgt
atgggattcaatgatcaagaaatcgttgctttgagtggtgctcatgctcttggtcgttgc
cacactgatcgtagtggttttgagggtccttggactttctccccaactgttgtcaccaat
gagtactacaagcttttgttgaatgagaagtggaactggaagaagtggaatggtcctaag
cagtacgaagacaagactaccaaaacccttatgatgcttccaactgacatggctctcgtc
tcggataaaactttccgttcatacgtcgagaaatacgctgcagatgaatctctcttcatg
aaagatttcgcaaatgttatcaccaagctctttgaactcggtgttcctttcgcagagacc
acagaacaaggtcctatgaaattcaagcctactgcctag

DBGET integrated database retrieval system