KEGG   Sclerotinia sclerotiorum: SS1G_12947Help
Entry
SS1G_12947        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ssl  Sclerotinia sclerotiorum
Brite
Protein kinases [BR:ssl01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   SS1G_12947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2430 aa AA seqDB search
MSQQSTQAFDALNRIVIDLRSRSDEQRKRAALELRELVEVASRDLPQERFLELYNVVNNK
ITSLISHGDLERTGGIYAVDALVDFEGIDVGQRVTRFGQSLRAVLRGKDLVPMQPAAVAL
GKMCRPGGSLVSDLVESEIKTALEWLQSDRIEERRYSAVLVLRELGRNSPTLVYTFVGLI
FDQIWVGLRDQRLLIRQTAAEAISACFQIIRERDQNLRQTWQAKIYDEAVQGVRQGTVES
IHGSLLVIKELLQQGGMFMHEHYPEVCEIVFRHKDHRDAQIRKTVVMLIPELAHYSPTEF
AQSYLHPFMVFLSGMLKKDKDRNDAFLAIGNIANAVKSAIAPYLDGVLIYVREGLSLKSR
RLGTVDPVFDCISRLAVAVGQTLSKYMEALLDPIFACELSPKLTQALVDMAFYIPPVKPI
IQERLLDMLSKVLCGEPFKPLGAPTPNNIAAAPVVPKDSKDPQAYEHRQSEIKLALNTLG
SFDFSGHVLNEFVRDVAIKYVEDENPEIREAAALTCCQLYVRDPIVNQTSHHAIQVVSEV
IEKLLTVGVGDPDPSIRRVVLAALDQRFDRHLAKAENIRTLFFALNDEVFQIREVAITII
GRLTHVNPAYVIPSLRKVLIQMLTELEFSDVARNKEESAKLLSLLVQNSQKLIKPYVDPM
IAVLLPKARDPSPAVAATIMKAIGELACVGGEGMIPYIKQLMPIIIEALQDQSSSAKREA
SLRTLGQLASNSGYVIKPYLEYPRLLEILQNIIRGEPQRGPLRQETIKLMGILGALDPYR
HQQVEERSPEMQLRLESNQMTDISLMMTGLTPSNKEYFPTVVINALLNILKDPSLNQHHA
MVIEAIMSIFRTLGLECVSFLDKIIPAFLSVIRTSPVNRLESYFSQLSLLVTIVRQHIRN
YLPEIVSVLQEFWNTSAPLQANILQLVEAISRSLEGEFKIYLAGLLPLMLGVLEKDTSTR
RLPSERVLHAFLVFGPSAEEYMHLIVPVIVSVFEKPQQPSFIRKAAIETIGKISRHVNLN
DYASKIIHPLSRVLAGSDSSLRLASLDTLCALIFQLGRDYLHFAGTINKVLNSHQIQHQN
YELLVSKLQKGEALPQDLSAEERYLNQSDEVDFSDVSNKKLDSNPVHLKAAWDATGKSTK
EDWQEWMRKFSAAVLLESPNHALRSCAQLASVYPPLARELFNSAFVSCWGELFEGYQDDL
IQNIEMAIKSPHVTPDLLGILLNLAEFMEHDDKALPIDIRVLGREAGRCHAWAKALHYKE
LEFCQDQTSGAVEALIQINNQLQQYDAAIGILRKAQLYKDGITLRETWFEKLERWEEALE
FYKRREEDFPDQAETFDVIMGKMRCLHALGEWESLSALAEDKWHTSSLEIKRAIAPLATA
AAWGLRKWDLMDDYLSVMKSHTPDRSFFGAILALHRNQFREAALFVQKAREGLDTELSAL
VSESYNRAYTVVVRVQMLAELEELSIYKQSDDNPKKQEVMRRTWETRLLGCQRNVEVWQR
MLKLRALVITPMENMQMSIKFANLCRKSGRMGLAEKHLKTLMGGDESLDVVLPQIVETAN
GERRLKVSTKHIEAPVQYAILKFQWAVGKQSQALEALKIFTSGLAEKLQQAQVANQGGVA
NEVHVMNGHNGTNGVMMNGNGYTNGLGANAQSLLTAKGLADHTTLLARCCLKQGEWQVAQ
KKGNWQYDNVNDILASYKAATHFNPQWYKAWHAWALANFEIVQSIQTELGHDWHNIPTNA
VIDHVVPAVRGFFKSIALSQGSSLQDTLRLLTLWFAHGGHVEVNQAVTEGFSSVSVDTWL
EVIPQLIARINQPNARVRASIHNLLADVGRAHPQALVYPLTVAMKSAPNTRRSRSAMQIM
DSMRQHSPKLVDQADLVSKELIRVAVLWHEQWHEGLEEASRLYFGDHNIEGMFNTLAPLH
DMLDNGPETLREISFAQTFGRDLQEAREWCITYQRTKDLGDINQAWDLYYQVFRRIARQL
PQLNNLELAYVSPKLLNAHDLELAVPGTYQSGKRIISIVNFESNFSVISSKQRPRKLSLK
GSDGNAYVFCLKGHEDIRQDERVMQLFGLCNTLLTSDSESYKRHLNIQRYPAIPLSQNSG
LLGWVPNSDTLHVLIREYRESRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNTT
GQDLYRVLWLKSKSSESWLERRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRITGNIVH
IDFGDCFEVAMTREKYPERVPFRLTRMLTYAMEVSNIEGSFRITCENVMRVLRENKESLM
AVLEAFIHDPLLNWRLNGEASPVGPNFRSERRESMISPQVRRPSVMDGNVPPSALTADVG
DPIAAPGGPPASRPRARTNSTTQGSQDIEAHENQNTRAVQVLVRVKEKLTGHDFKPEEEL
PYIQQVDKLLIEATKLENLCQHYIGWCSFW
NT seq 7293 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacaatcaactcaagcattcgatgctttgaatcgcattgtgatagatttacga
tcacggagcgatgagcaacgaaaaagggcagctttagagttgagggagctagtggaggtc
gcttctagagatctcccccaagaacgatttctagaattgtataatgtagttaataacaag
atcaccagcctaatcagccatggagatttggagcgaactggtggtatatatgccgtcgat
gcgctggtcgatttcgagggtatagatgttggacaacgagtcacacgatttgggcaatcc
cttcgagctgtattgagaggaaaagatctcgttcctatgcaaccggccgctgtagcattg
ggaaagatgtgtaggcctggtggttcgttggtatctgatctggtggagagcgagattaaa
actgccctggaatggttgcaatctgatcgaatcgaagaaaggagatacagtgcggtactg
gttctgcgagaattgggccgaaattcaccaacactagtttacacttttgttgggttgata
ttcgaccagatatgggtgggattgagagaccagcggctccttattcgacagaccgccgca
gaagctataagtgcgtgctttcaaataatcagagagagagatcaaaatttacgacagaca
tggcaggccaaaatttatgatgaagccgtccagggcgtgagacaggggaccgttgaatcc
atccatggatccctgctcgtgatcaaggaacttcttcagcaaggcggaatgtttatgcat
gagcattatccagaagtttgcgagattgttttccgacataaagatcatcgggacgcacag
attcggaagaccgtcgttatgctgatacccgagttggcgcactattctccaacggagttt
gctcaatcctaccttcatccattcatggtgttcttgtcaggtatgcttaagaaggacaag
gatagaaacgacgctttcttggccattgggaatattgccaatgctgtcaaaagtgctatt
gcgccttacctagacggagttctaatatatgtccgagaaggcttgtctttgaaatcgaga
cgactcggcacggtggatccagtgttcgattgcatcagtagattagcagtggccgttgga
caaactctcagcaaatatatggaggcactcctagacccgatcttcgcatgtgagctaagt
cctaagttgactcaagctttggtggatatggctttctacattccgccggtgaaaccaatc
atccaagaaagattactggatatgttgagcaaggttctttgtggtgagcctttcaagcca
ttgggggcacctacaccgaataatattgcagccgcgccagttgtaccaaaagactcgaag
gatccacaagcgtatgagcatcgacaaagtgagatcaagctcgctcttaataccctgggt
agtttcgacttctccgggcacgtactaaatgaatttgtgcgtgatgttgccatcaagtat
gtcgaagacgaaaatccggaaatcagagaggcagctgcattgacttgctgtcagctttat
gtccgagatcctattgtcaatcaaacaagtcatcatgcaattcaggttgtcagtgaagtt
attgagaagctgctcacagtcggagttggggatccagatcctagcattcgaagagttgtc
ttagcagccttagatcaacgatttgaccgacaccttgccaaagcagagaatattcgaact
ctgttcttcgctttgaatgatgaagtattccaaatccgtgaagttgctatcacaatcatt
ggtcgtttgacgcatgttaatcccgcatatgtcattccctctttgcgtaaggttctcatc
caaatgcttacagaacttgagttttctgatgtagcgaggaacaaggaagaaagtgcaaaa
ctccttagtctcctcgttcagaattcacagaagctgatcaagccctacgttgatcctatg
attgctgttctattacccaaagctcgtgatcctagcccggcggttgctgctactatcatg
aaagctatcggcgaacttgcatgtgtgggaggagagggtatgattccatatatcaagcag
ctcatgccaataattatcgaagctttgcaggatcagagctcttctgctaagcgagaagcc
tctttacgaactttaggtcagttggcaagcaattcaggttatgtcattaagccttatctg
gaatatccccggcttttggagattttgcaaaacatcattcggggagaaccgcagagagga
ccattacgacaagaaactatcaaattgatgggtattcttggcgctttggacccgtatcga
catcaacaagttgaagagcgatctccagagatgcaactacgtttggagtcaaatcaaatg
acggacatatctcttatgatgacaggtcttacaccttctaacaaggaatatttcccaact
gtcgtgatcaatgctcttctcaacattttaaaggacccatctctcaatcaacaccacgcc
atggtcattgaggcaattatgtcaatattcaggactctgggtttagaatgcgtctctttt
ctcgataagattattccggcatttttgtctgtcatccgaacctctcccgtcaatcgtctg
gagtcatatttcagtcaattgagtctcctggtgaccatcgttcgacaacatatccgtaat
tacttaccagagattgtgtcggtacttcaggaattctggaatacgtctgcaccacttcaa
gctaacatacttcaacttgtcgaggctatttcaagatctctagaaggcgagttcaagatt
tacttagcggggctattgccgcttatgttgggcgtacttgagaaagatacctccaccagg
cgccttccttcagagcgtgttttacatgcttttctggtgttcggtcctagtgctgaggag
tacatgcacctcatcgtacctgttatcgtcagtgtgttcgaaaagccgcagcaaccttca
tttattcgaaaggccgcgattgagactatcggtaagatttcaagacatgttaatctcaat
gactatgcctccaaaatcattcaccctctttcgagggtcttggctggtagcgatagctct
ttgagattggcgtcgctcgatacactttgcgcactgattttccagctcggaagagattac
ttacatttcgccggcacaatcaacaaggttctgaacagccatcaaatccagcatcaaaat
tacgaactcttggttagtaaacttcaaaaaggtgaagctctgccacaagatttgagcgcc
gaggaacggtacttgaatcaatctgatgaagtcgacttctcagatgtctctaataagaaa
ttggatagcaatccggttcatttgaaggcagcttgggatgcaacaggtaaatccacaaaa
gaggattggcaggagtggatgcgcaaatttagtgccgccgtcttattggaatcaccgaat
catgcacttcgatcatgtgctcaactagcttcagtatacccgccgctcgccagagaacta
ttcaattctgcttttgtttcatgttggggagagctatttgaaggttatcaagatgacttg
atccaaaacattgaaatggcaatcaaatctcctcacgtcactcctgatctcttaggtatc
ttactcaaccttgcagaattcatggagcatgatgataaggctttgcccatcgacatacga
gttctaggacgagaagctggtagatgccatgcctgggccaaggctcttcactacaaggaa
ttggagttctgtcaggatcaaactagtggtgctgttgaagcattgattcaaatcaataac
cagttacagcagtatgatgccgcgattggtatcctacgaaaagcacaactttacaaggac
ggtatcacattacgagagacttggtttgaaaagcttgagagatgggaagaggctcttgaa
ttctacaaaagacgcgaggaagatttccctgaccaagcagaaactttcgacgtcatcatg
ggtaagatgagatgtcttcatgctttgggagagtgggaatcactatcggctttagctgag
gacaaatggcacacctcttcactggaaatcaagcgagccattgcacctttggctacagcg
gctgcttggggtctcagaaaatgggatcttatggacgattatctcagtgttatgaagagt
cacacacccgatcggtcattctttggggcaattcttgccttgcatcgtaatcaattccgc
gaggctgcactctttgtccaaaaggcgagagaagggctagataccgaattgagtgctttg
gtcagcgagtcctacaatcgagcctacacggtcgttgttcgcgtacagatgcttgcagaa
ttggaagagcttagcatttataagcaaagcgacgacaatcctaaaaagcaagaagttatg
cgccgaacttgggagactcgtttgcttggatgccaacgaaatgttgaggtttggcagaga
atgttgaagttaagagccttggtcataactccaatggagaacatgcagatgtccatcaaa
ttcgcgaacctttgcagaaagtctgggcgtatgggcttagccgaaaagcatctcaagact
ctgatgggtggagatgagagcttggatgtggtgttacctcaaattgttgagactgctaat
ggagaacggcgactgaaagtttcaaccaaacatattgaagctcctgttcaatatgctatc
ttgaaatttcagtgggcggtcggcaagcaatctcaagcattggaggctctgaagatattc
acatctggactggcagagaaactgcagcaagcacaggtggcaaatcaaggaggtgttgcg
aatgaggtgcatgttatgaatggtcataatggtactaacggagtaatgatgaatggaaat
ggttatactaatggtctgggagcaaatgctcagagtctgctgacagcaaagggcttagct
gaccataccacgctactcgctagatgttgccttaaacaaggtgaatggcaggttgctcag
aagaaaggtaattggcaatatgacaatgtcaacgatattctcgcctcatataaagctgcc
actcactttaatccacagtggtacaaggcatggcatgcttgggctttggcaaactttgag
attgtccagtccattcaaacagagctaggacacgactggcataatatacctactaatgcc
gtcattgatcacgtcgttcctgctgttcgtggtttcttcaagtcaattgctctctcgcag
ggaagttctttacaagatacattgcgccttcttacactttggttcgctcatggtggacat
gtagaagtcaatcaagccgttactgaaggattctcatccgttagcgttgacacttggttg
gaagtcattcctcaacttattgcacgcatcaaccaaccaaatgctcgtgtccgggcttcc
attcataatctgctcgctgatgttggaagagctcacccacaggcgctggtctatccattg
actgtcgccatgaagtctgcaccgaatacacgtcgctcacgatctgcaatgcaaatcatg
gatagcatgcgccaacatagtccaaaattggtggatcaagcagatttagtcagcaaagag
ttgattcgcgtggcagtattatggcatgagcaatggcatgaaggtcttgaagaggcatcc
agactttactttggtgaccataatattgagggcatgttcaatacactcgcacctttacac
gatatgctcgacaacgggccggagaccttgcgagaaatttcttttgcccaaacattcggc
cgtgatcttcaagaggctcgagaatggtgtatcacttaccaaagaacgaaggatctcgga
gacatcaatcaagcttgggatttgtactatcaagttttcagaagaatcgcacgccagcta
ccgcaacttaataaccttgagctggcttacgtatctccaaagcttcttaatgctcatgat
ctggagctggctgttcctggaacttatcaaagtggcaagcgtatcatatcgatcgtcaat
tttgagagcaatttcagtgttatctcctccaagcaacgtccaagaaagcttagtctcaag
ggtagtgacggtaatgcctatgtcttttgtcttaaaggtcatgaagatattcgtcaagat
gagcgtgttatgcaattgttcggtctttgcaatacattacttactagcgattcggagtct
tacaaacgtcatcttaacattcaacgatatcccgctataccattgtctcagaattctggt
ctccttggttgggttcctaatagtgacaccttacatgtccttattcgagagtacagagaa
agtaggaagatactactcaacattgagcaccgaattatgttacagatggctcctgattac
gacaatcttaccctcatgcagaaggttgaagttttcggttatgctctcgacaatacaact
ggacaagatctttatcgtgttctctggttaaagagcaagagttctgaatcctggctggaa
agacgtacaaattacactcgatcattaggagtgatgtcaatggtcggatacattcttggc
cttggtgatcgtcatccttcgaatttgatgcttgatcgaatcactggtaacattgttcac
attgattttggagattgtttcgaagttgctatgactcgtgagaagtatccagaacgtgtt
ccattcagattgactaggatgttgacctatgctatggaagttagcaatattgaaggaagc
tttagaattacttgcgagaacgtgatgagagtgttgagagagaacaaagagtctttgatg
gctgttcttgaggctttcatccatgatcctcttctcaattggcgtttgaatggcgaagct
tcacctgtaggacctaatttccgctccgagcgccgtgaatccatgatctcgccccaagtc
cgtagaccctcagtaatggatggaaatgttcctccttcggcgttaactgccgatgttgga
gatccgatagcagctccaggcggaccaccagcttcacgtccccgcgcaagaacaaattcc
acgacacaaggttcacaggatatagaggcacatgaaaaccaaaacaccagggctgttcag
gtattggtccgtgtcaaggagaagttgacaggtcatgatttcaagccagaggaggaatta
ccatatattcaacaagttgataagttgttgattgaggcgacaaagttggagaatctttgc
caacattatattggttggtgtagtttctggtag

DBGET integrated database retrieval system