KEGG   Sclerotinia sclerotiorum: SS1G_13049Help
Entry
SS1G_13049        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SS1G_13049
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SS1G_13049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1382 aa AA seqDB search
MYSRLPPEPQRKEPQIDLYPDTQDEGSKSGFSNYLDEFLSAIKIFGYLERPVFHELTRSM
QTRKLIAGETLNLEEEKGFCLVVDGLVEIFVKSAREGRESDTDPTSYEREDSDSGSGPHR
GGHHQGYQLLTEVKNGAPMSSLFSILSLFTEDVKLRHSDDEDFDGSVSGTPYGNSDHHEF
GNSHEAPPSLPTSPIYGALTQDGQRDGRDRRASATNVNGRIPPLSLDASADIHPRRPRPK
RLTTTSVHPDIVARATVDTTIAIIPASAFRRLTRVYPKATAHIVQVILTRLQRVTLATGH
SYLGLTSEVLRTEKHMNKYTTYELPNFLRGDALKRLKEKFIREKERIGTEEGSKGIALHN
AGAGRRRRSSHSLRKEATMHASSVSASMSMSRQTFEAHGGDSSVSPSPGDLLTNIQMSRY
GGRKPASSVKGSSPQVWHHDAQSPLSQRTSNPFNSPMNSRIPLHRQESIDEDGMFRKSIL
ECIFKAIGLTNTKNALRMSDSVEGSPRMLSYDQKRQKAFFTNNSFTTNAFGLIDPYEGSV
DDTESVTSGGVSAGGYPSTQGLAQELKDEVEIVYFPKGSVLVEQGERNPGLYYVIDGFLD
VSVPVDEKSDSMVLGQSFRHSSNAKNANDPMPSLSRTKTASSRASGSAFGSAGHEGKKRK
TTDRKSLALIKPGGIAGYIGTISSYRSFIDVVAKTDVYVGFLPRTSLERIVEKYPVVLLT
MAKRLTSLLPRLILHIDFALEWVQVSAGQVIYHQGDDSDAIYIVLNGRLRLVVNNDEAGM
KVIGEYGQGESVGELEVMTESVRPATLHAIRDTELAKFPKTLFNSLAQEHPGITIKISKI
IASRMRALVEEPVFVQTKEKVTGATNDKVSSTVNLRTVAILPVTAGVPVVEFGSRLMNAL
TQIGAPNGVTSLNQAAILNHLGRHAFSRMGRLKLSQYLADLEEKYGLVLYIAADGSPAIG
EYERFLLGMKTTARKELVLLHADRFSSPGVTRAWLRNRVWINGGHHHVQMDFRTSAVPVH
PQTRKFGTALKQRVQVIQAEIQKFTSRRVRQSPLYSAETPFKGDFHRIARRLCGKSIGLV
LGGGGARGISQVGIIKAMEESGIPIDIIGGTSIGSFIGALYARDADVVPMYGRAKKFSGR
MASMWRFALDLTYPSASYTTGHEFNRGIFKTFGNTQIEDFWLEFYCNTTNISKSRSEIHT
SGYAWRYVRASMSLAGLLPPLCDEGSMLLDGGYVDNLTVSHMKSLGADIIFAIDVGSLDD
DIPQNFGDSLSGFWAFANRWNPFSSYPNPPTLAEIQARLAYVSSVDALERAKTTPGCLYM
RPPIDEYGTLDFGKFDEIYQVGYKFGHEYLAKMREQGILPLVDETEEKKALRRTMAPRRA
SI
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgtactctcgattacccccggaacctcaacgaaaggaacctcaaatagacctctatcca
gatacacaagacgaaggatcaaagtcagggttctcaaattacttggatgaatttctgagt
gctatcaaaatctttggttatttggaacgtcctgtttttcatgaactcacgcgctccatg
caaacaagaaagctgatagctggcgaaaccttgaaccttgaagaggagaagggattttgt
ttggtagtcgatggattagtggagatttttgtcaaatcggctcgagaaggacgtgaatca
gataccgatcccacgtcgtatgaacgagaagattcggatagtggatctggccctcaccga
ggtggtcatcatcagggttaccaattattgaccgaggtaaagaatggtgcacctatgtca
tctctcttttctatactttcactctttacagaagatgtcaaattgagacattctgatgac
gaagattttgatgggagtgtttctggtactccttatggcaattcagatcatcacgaattt
ggaaatagccatgaagctcctccatcacttcccacaagtccaatatatggggcccttact
caagatggtcaaagagatggtagggatcgtcgtgcttcggcaacaaatgttaatggaaga
atacccccgttgtcattagatgcttcagccgatattcatccacgtcggcctaggcctaag
aggttgactacaacttccgtacatcctgacatcgtggctagagctacagtggatactaca
attgctataatacctgctagcgctttccgtcgattaacaagagtatatcctaaggctaca
gcacatatcgtccaggtcattttaacaagattacagagagttactcttgcgactggtcat
tcttatcttgggttaactagcgaggttttgcgcactgaaaagcatatgaacaagtacacg
acatacgaattgccgaatttcctccgtggagatgcgttgaagcgcttgaaggaaaagttc
attcgcgaaaaggagaggattggcacggaagaaggtagcaaaggtattgctttgcataat
gctggagccggaagacggcgcagatccagtcatagcctcagaaaagaagccacaatgcac
gcatcgtcggtcagtgcttctatgtcgatgtccagacaaaccttcgaagcacacggtggg
gattccagtgtcagccctagtcctggagatcttcttacgaatattcagatgtcacgatac
ggtggtaggaaacctgcttcaagtgtgaaaggttctagtcctcaagtatggcatcatgat
gctcaaagtcctctttctcagaggacttcaaatccattcaatagtcctatgaattcacga
atacctcttcatcgccaagaatcgattgatgaagatgggatgtttaggaaatctattttg
gaatgtatattcaaggctatcggtcttacaaacactaagaatgcattgcgtatgtcagat
tctgttgaaggctcgcctcgaatgctttcatatgatcagaagcgtcaaaaggcatttttt
accaacaattcctttactaccaacgccttcggccttattgatccctacgaaggttctgta
gatgacactgaatcagtgacatctggtggagtcagtgctggtggatatccaagtacgcag
gggcttgcccaagaactcaaggatgaagtagagattgtttacttcccaaaaggctcggta
cttgtggaacaaggagagagaaaccctgggctgtattatgttattgatggcttcctagat
gttagcgttcctgttgacgagaagtccgattccatggtgttaggccaatctttccgacac
tcttcgaacgccaagaacgccaatgatccgatgccttcactatctagaacgaagaccgcc
tcatcgcgtgcttcagggtctgcttttggtagtgcagggcatgagggtaaaaagagaaag
acaacagaccgaaaaagtttggcacttataaaaccaggtggtattgcaggttacattggt
accatatcctcttatcgatcgttcattgatgttgttgcaaaaacagacgtttatgtagga
ttcttgccgcgaacatcactggaaagaattgttgagaagtatcctgtcgtactcctgact
atggctaaacgtctcaccagtctattgcccagattaatcctgcacatagactttgctctt
gaatgggtacaggtgagcgccggtcaagtcatctaccaccaaggcgatgatagtgatgca
atttacattgtcttgaacggccgacttcgacttgtagtcaataatgacgaggctggaatg
aaagtcatcggcgagtatggacaaggtgagagtgttggagaactagaagtcatgacggaa
tcggtcagacctgctacactgcatgctattcgagatactgaactcgctaaatttcccaag
acacttttcaacagtctagcgcaagaacacccaggtatcacgatcaaaatctccaagatt
attgcatctcgcatgcgagctttagtggaagagcctgtcttcgtacaaactaaagagaaa
gttactggtgctacgaatgataaagtatcttcgactgtcaatcttcgtactgttgctata
cttcccgttaccgctggagtacctgtggtcgagtttggtagtcgtttaatgaatgctttg
actcaaatcggagcacctaatggtgtaacttctctcaatcaagcagctattcttaatcat
cttggcaggcatgctttcagtcgtatgggaagacttaaactttcacaatatcttgctgat
ctggaggagaagtatggcctggttttgtatattgctgcagatggttcaccagctattgga
gaatacgaacgcttcttattaggaatgaaaaccactgcgagaaaggaattggtattattg
catgcagaccgcttctcatcacctggtgtgactcgtgcatggcttagaaatcgagtctgg
atcaatggcgggcaccatcatgtgcaaatggacttcagaactagtgctgtcccagtacat
cctcaaacaagaaagttcggaaccgcattgaaacaacgagtacaagtgattcaggcagaa
attcaaaaattcacatcccgccgtgtacgacaatcgccactttactccgcagagactcca
ttcaaaggcgactttcaccggatcgctagacgtctttgcggcaaatctattggtctggtt
ctcggaggaggtggtgcacgtggtatatctcaggttgggattataaaagctatggaagaa
tctggaattccgattgacataattggaggaacttctattggatctttcattggcgcatta
tatgctcgtgatgcagatgtagttcctatgtatggacgcgcaaagaaattttcaggccgc
atggcaagcatgtggcgctttgcactggatttaacgtatccatctgcttcctatactact
ggtcatgaattcaaccgtggtatcttcaagacgttcggcaatactcagattgaagatttc
tggctagagttctattgcaacactaccaatatcagtaaaagtcgatctgaaatccatacc
agtggatatgcatggagatacgtaagagcatctatgtctcttgctggacttctcccacca
ctgtgcgatgaaggaagtatgctgttagatggtggatatgtagataacctgacggtttct
cacatgaagtctctaggcgctgatatcatctttgctattgatgtcggcagccttgatgac
gatataccacagaacttcggtgactcactttctggattctgggcatttgcaaatcgttgg
aacccattctcatcatatccgaatcctcccactttggctgagatccaagcacgtttggca
tatgtatccagtgtcgatgctttggaaagagcgaaaacaactccaggatgtctttacatg
agacctccaattgacgaatatggaactctggactttggtaaattcgatgaaatttatcag
gttggttacaaattcggacatgaatatttggcaaagatgagagaacagggtattcttcct
ctagtggatgagacggaagagaaaaaggcattgaggagaactatggctccgagacgagca
agtatttag

DBGET integrated database retrieval system