KEGG   Sclerotinia sclerotiorum: SS1G_13076Help
Entry
SS1G_13076        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K05759  
profilin
Organism
ssl  Sclerotinia sclerotiorum
Brite
Membrane trafficking [BR:ssl04131]
 Others
  Actin-binding proteins
   Others
    SS1G_13076
Cytoskeleton proteins [BR:ssl04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     SS1G_13076
Exosome [BR:ssl04147]
 Exosomal proteins
  Proteins found in most exosomes
   SS1G_13076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 96 aa AA seqDB search
MSWQVFAEADMLKRELSTIWRETLAGPPALTSARDMFLQRWMRRLKFSLLEKGKDGLVIG
KTVQAIVIARYVDPMIAGNTSETVQKLVDYLVKVGY
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggtctttgcggaagcggacatgttgaaaagggagctatctacaatttgg
agggaaactcttgctgggccaccagccctgacttccgcgagagatatgttcttacaaagg
tggatgaggagactaaagttctctttgctagaaaagggtaaagatggtctcgtcatcggt
aaaaccgtccaagcaattgtcatagctcgatacgtcgacccaatgatcgcaggaaacacc
tcggagactgttcaaaaattggtcgattatcttgttaaagttggctactaa

DBGET integrated database retrieval system