KEGG   Sclerotinia sclerotiorum: SS1G_13300Help
Entry
SS1G_13300        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SS1G_13300
Enzymes [BR:ssl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SS1G_13300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 791 aa AA seqDB search
MRLLSISLLSTVFASVVLAQSEEQKLENSSPELPGELSADEASDVPQPTIFNGVEVPPLP
EIDGESFNKTIADGYWFVKHHSPYCPHCIHIAPTWQTLYEFYYTSKPVKSGTDDTTSTSM
NSFTAYYNYHFGSLDCIAFGTACSDHGVTSFPTFILYKDGEESKRFVGPKDMEKLGAFIE
ESLELIRPGSRPIGGPKFPQERDTQSPDYKPTAATSKETEKTTEKSTEKVSDKSPEKSSE
KSTEKSSEGSAQKPEKAAEKVSEKATEKAADIVVPAKDAVKDTVKDVKDGAKDVVKDAVK
DTKADTAKITTKPTLKATSIEKKPSKPTQTANPLGTSVSLTAESFQNLVTMSQDPWFIKF
YAPWCHHCQAMAPNWAQLAKEMKGKLNVGEVNCEAEARLCKDVHVRGYPTIHFFRGGERV
EYEGLRGLGDFVTFANKAVDIGDGVKDIDAAGFKELEEKEDVIFVYFYDHATTSEDFAAL
ERLTLSLIGHAKLVKTNSAALADRFKITTWPRLLVSRDGRPTYYTALAPQDMRDFRQVLH
WMQSVWLPVVPELTASNSREIMDGKIVVLAILSREREADFAMAKKELKQAALEWMDKQII
NFQRERQELRDAKQLRLEEAEDRNDQRALRAAKSIRINMDKSDQKEVGFAWVDGVFWERW
IRSTYGIDVKTDGEKVIINDEDNRRYWDTTITGNYIIPSRTSILETIPKVVSNPPVIKPK
STVGSFEKMFFSIRGAISGHPFLSFGVALGMILGATLYGRGKIGAKRGGFFRVDDGKDGL
LGGVNGGGKVD
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttctttcgatttcattactatctaccgtctttgcctctgttgtattggcacaa
tctgaagaacagaagttggagaattcctctcctgaattacctggagaactctctgcggat
gaagcctcagatgtaccacaaccaacaatatttaatggagtcgaagttcccccccttcct
gaaatagatggagaatcttttaataagacaatcgcggatggatattggtttgttaaacat
cactcaccttactgcccgcattgcatacacatcgcgccaacatggcaaactctttacgag
ttctattatacttcgaaacctgtcaagtctgggactgatgatactacttctacatcaatg
aactcgttcacggcttactacaattatcatttcggttcgctcgattgtatcgctttcgga
actgcctgttcagatcatggagtaacttctttcccaacctttatattatataaggatggc
gaggaatcaaagagatttgttggacctaaggatatggagaaattgggtgctttcattgag
gaaagtctagaattaattagaccagggtctagaccaattggtggaccaaagttcccacaa
gaacgcgacacacaaagtccggattataaacctacagcagcgacctcgaaggagaccgaa
aagacaaccgagaagtccacggagaaggtatccgataagtcacccgaaaagtcatcagag
aaatccacagaaaagtcatccgaaggatcagcgcagaaaccagaaaaagcagcagagaaa
gtctcagagaaagccacagaaaaggccgcagacatcgttgtgccagcaaaggatgccgtt
aaggatactgtaaaggatgttaaggatggtgctaaggatgtcgtcaaagatgctgtcaaa
gacacaaaagccgacaccgccaaaattactaccaagcccaccctcaaagctacatcgatc
gaaaagaaaccttcaaaaccaacccaaactgcgaacccacttggaacatctgtatcactc
acagcagagagctttcaaaatttggtcacaatgtctcaagatccttggtttatcaaattt
tacgctccatggtgtcatcattgtcaagctatggctcctaactgggctcaattggcaaaa
gagatgaaaggaaaacttaatgttggagaggttaattgtgaagcagaggctaggttatgt
aaggatgttcatgttcgtggatatccaaccattcatttcttccgtggtggagaacgtgtt
gagtatgaaggacttagaggattaggtgactttgttacctttgctaacaaagctgttgat
attggtgatggtgttaaggatattgatgctgctggattcaaggaattggaagagaaagaa
gatgttatcttcgtttacttctatgatcatgccactaccagcgaggattttgcggcattg
gaaagattaaccttgagtttaattggtcacgccaaacttgtcaagacgaacagtgctgct
cttgccgatcgattcaagattacaacttggcctcgtctattggtatctcgagatggtaga
ccaacctactatacagcactcgcacctcaagatatgcgtgatttcagacaagttctacat
tggatgcaatcagtttggttacctgttgtacctgaactcacagcttcaaattcacgcgaa
atcatggatggtaagattgtcgttctagcaattctatctcgagaacgtgaagccgatttc
gcaatggctaagaaggaattgaagcaagctgcattggaatggatggataaacaaatcatc
aatttccaacgtgagcgccaagaattgagagatgctaaacaacttcgattggaagaagcc
gaggatcgtaatgatcaaagagctttgagagctgccaaaagtatcagaattaatatggat
aaatctgatcaaaaggaggttggattcgcttgggttgatggtgtattttgggaaagatgg
attagaagtacctatggtattgatgttaagactgatggtgaaaaggttattattaatgat
gaagataatcgtcgctactgggatacgacaatcactggaaactacatcattccttcccgt
acctcaattttggaaacaattccaaaagttgtatccaatcctcccgtcatcaaaccaaag
agtactgttggttcatttgaaaagatgttcttcagtattagaggagcaattagtggacac
ccattcctcagtttcggagtagctttaggtatgatcttaggagctacattgtatggtaga
ggaaagataggagcgaaaaggggaggattctttagggtagatgatggaaaagatggattg
ttaggtggagttaatggtggaggaaaagttgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system