KEGG   Sclerotinia sclerotiorum: SS1G_13577Help
Entry
SS1G_13577        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ssl04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 485 aa AA seqDB search
MPTLGFLKKKRTKESPGITSPTSSQATSPITPTSSRGFDNSIASISTQSTLPQSHEHEVL
QTTTSRTADQPAAVAKKASMTQGITQQQQSAQIHSDQHQHRQNSPSISNLIHPPQHDGAS
QSYPTPPTSSQTSLHPVAGNTSTLQMDASHRHSQQAQQQPQIRQTKGKYSLTDFEIQRTL
GTGSFGRVHLVRSKHNQRYYAVKVLKKAQVHKMKQVEHTNDERRMLQEVKHPFLITLWGT
FQDSKNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSKQIIYRDLKP
ENLLLDRHGHLKITDFGFAKKVPDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIF
EMLCGFTPFWDGGSPMKIYENILKGRVKYPPYIHPDAQDLLQRLITADLTKRLGNLHGGS
EDVKNHQWFAEVTWERLSKKDIDAPYVPPVKAGVGDASQFDKYPEETEIYGQGGPDEFGH
LFVDF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccgacactcggatttttgaagaagaaacggacgaaggagtctccgggtataacctct
ccgacatctagtcaagccacaagtccgataacccccacatcatcaagaggcttcgataac
tccatagcttccatatctacccagtctactttaccccaatcccacgagcacgaggttctt
caaactacaacctctcgcacagcagaccagcctgctgctgtggccaaaaaagcctcaatg
acacaagggataactcaacagcagcaatctgcgcaaattcattccgaccaacatcagcat
aggcaaaactccccaagtatcagcaacttgattcatccaccacagcatgacggcgcgagc
cagtcatatccaaccccaccaacctcctcgcaaacttcgctgcatcctgtagctggtaac
accagcacactccaaatggatgcctcgcaccgacattcccagcaagcacagcagcagcca
cagatcagacaaaccaagggcaaatattcattgaccgacttcgaaatccagcgcacatta
ggtactggaagttttgggcgagttcatttagttcgatcgaagcacaaccaacgatactat
gctgtcaaggtattgaagaaggctcaggtgcacaagatgaagcaggtcgaacataccaat
gatgagaggagaatgttgcaagaagtcaaacacccattcctcatcactctatggggtaca
ttccaagattcaaagaatttatacatggttatggattttgtagagggaggtgagctattc
tctttactgagaaaatcacaaagattccctaacccagtagccaaattttatgccgctgaa
gttacattggcccttgaatatctccattcaaaacaaatcatctatcgggatctaaagcca
gagaatttacttcttgacaggcatggacatcttaagattactgattttggattcgccaag
aaggtcccagatatcacatggacattgtgcgggaccccggattacttagcaccagaagta
gtctcaagtaaaggttataataagtctgtagattggtggtcgcttgggatactgattttc
gaaatgctttgtggtttcacgccattttgggatggtggctcacctatgaagatttatgag
aatatccttaaagggagggtcaaatatcctccatatattcacccagatgcacaagattta
ttacaacgattgatcacagcagatcttaccaaacgtcttggcaacttacatggaggctct
gaggacgtcaaaaatcatcaatggtttgccgaagtaacttgggaaaggttatccaagaaa
gatattgatgcgccttatgtccctcctgtcaaggccggagtcggtgatgctagtcagttt
gataaatatcccgaggaaacggagatatatggtcaaggtgggcctgatgaatttgggcac
ctatttgtcgatttttaa

DBGET integrated database retrieval system