KEGG   Sclerotinia sclerotiorum: SS1G_13725Help
Entry
SS1G_13725        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SS1G_13725
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SS1G_13725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 383 aa AA seqDB search
MAQQHLDVDGLRLEEVDRSLDDERKQELERLWGFEWSFSGISTFAHLEYKKCLTTPDELF
DIGILGVPFDTAVSYRPGARFGPKAIRSASARQTSFRGFNTRAGINPYTSFARIIDCGDI
PVTPLSNAVALEQMTAAYTELLNRKPVSSSLIHPKIISLGGDHSIALAALRALQKVYNQP
IAVLHFDAHLDTWHPAKYPDPWASEQAQFNHGSMFWLASNEGLIINGSSVHAGLRTRLSG
NDFEDYEDDDRQGFLRISADDIDDLRPQGVVKKIMERIGTEVPVYLSIDIDVLDPGVAPG
TGTPEPGGWTMRELIRILRGIEGLNVVGADVVEVSPSYDGAGEETALSASQIIFEMLTSI
VKRGLSDMGRVAEIKESRKNDEL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaacatttggatgttgatggattgagacttgaagaggttgatcgaagtttg
gacgacgaaagaaagcaagaattggagagactttggggttttgagtggtcattctcagga
atctcaacatttgctcatctggaatacaagaaatgtctcactactcccgatgaacttttc
gatataggaatcttaggtgtgccatttgacactgcagttagctatcgacctggggcaaga
tttgggcccaaggctattcgatcagcgagcgctagacaaactagctttagaggattcaat
acacgagctggtataaacccatacacatcgttcgctcgcattatcgattgtggggatata
cccgtcacacccctgagtaacgctgttgcattagaacaaatgacagcagcctacaccgaa
ctactcaaccgaaagcccgtttcctcatctctcatccacccaaagatcatttccctagga
ggtgaccatagtatagccctagcagcactcagagctctccaaaaagtatacaatcaacca
atcgccgtcctacatttcgacgctcatctcgatacctggcatccagccaaatatccagat
ccatgggcaagtgagcaagcgcaatttaatcacgggagtatgttttggctcgcttcaaat
gaaggtctaatcataaatggtagcagtgttcacgcagggttaaggaccagattaagtggt
aacgattttgaggattatgaagatgatgatagacaaggttttctgaggatctcggcggat
gatattgatgaccttagacctcaaggtgtggttaagaagattatggaaagaattggaact
gaggttccggtttatcttagtattgatatcgatgttctggatccaggcgtggcgccagga
acaggcacgcctgagcccggtggctggacaatgagggagctaatcagaatactgagggga
attgagggattaaatgttgtgggtgcggatgtggtggaggttagtccaagttatgatgga
gcgggagaggaaacggcactcagtgcgtcgcagataatttttgagatgttgacgagtatt
gttaagaggggtttaagcgacatgggaagggtcgcagaaatcaaggaaagcaggaagaac
gatgagctgtga

DBGET integrated database retrieval system