KEGG   Sclerotinia sclerotiorum: SS1G_13763Help
Entry
SS1G_13763        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SS1G_13763
Peptidases [BR:ssl01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   SS1G_13763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 272 aa AA seqDB search
MAEVTDNPDVPSNKKAFIPLGISSSAPLKHPPYHPKLTPPENNPEVMSSLLHKLGLSTTL
SFHDVFSIEDPSLLSFIPRPALALLLVFPVSKTYEEFRYSEDKDREDYKGKGEDEPVIWY
KQTIRNACGLIGLLHAVSNGAAKGFVGQDTPLGKLIKDAIPLGAFDRADLLYNSQALESA
HQSAATQGQSSTPDAEDNVDLHYVCFVKDEKNDLWEMDGRRRGPLELGSLGPDEDVLSEK
ALDWGVRKFLKREEENGAELRFSLIALAPSLD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagtaacagataatccagatgtcccttcaaacaagaaggcttttattccttta
ggtatctcatcctctgctccactcaagcacccaccctatcatcccaagctaacccctcca
gaaaacaaccctgaagtaatgtcctctctcctccataagctcggtctctcaaccacactc
tccttccacgacgtattctccatcgaagacccatctttactctccttcattccccgtcct
gctctcgctctcttgttagttttcccagtctccaaaacctatgaagaatttcgctattct
gaggataaggaccgggaagattataagggtaaaggagaggatgaaccagttatttggtat
aaacagactattaggaatgcatgcggtttaattgggctcttgcatgctgtgagtaatgga
gctgcaaagggttttgttggacaagatactcctctcggcaagctaattaaagatgcaatt
cccctcggtgccttcgatcgtgcggatcttctatataattcccaagcccttgaatccgcc
catcaaagcgccgcaacccaaggccagtcctctacgcccgatgccgaagacaacgtcgat
ttacactatgtatgtttcgtgaaagacgagaagaatgatctgtgggagatggatgggagg
agaagaggcccactcgagttgggatcactgggaccagatgaggatgttcttagtgagaag
gcattagattggggagtgagaaagtttttgaagagagaagaggagaatggtgctgaattg
agatttagcttgattgcattggcaccaagtctagattag

DBGET integrated database retrieval system