KEGG   Sclerotinia sclerotiorum: SS1G_13809Help
Entry
SS1G_13809        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SS1G_13809
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SS1G_13809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 622 aa AA seqDB search
MRFYSVTAVLSLLCTQAIATSPSDSAASYNNLNSFIASERKIALQGVLNNIGPDGSKVSG
AGNYVVASPSKANPDCESNILDFYTWTRDSALTLKMIVDEFIFGNRALQPQIEKYVKAQA
ILQTVTNPSGSLLYDGLGLGEPKYKVDGTQFNGAWGRPQRDGPALRAIALMAYSNWLINH
DQFQRAKLVIWPIISNDLSYIGEYWNSTGFDLWEEELGSSFFTLQNQHRAFIEGQTLANK
LGVECTGCLNAPEVLCFLSQSFWNGEYIISNVNVDNGRTGLDANSILGSISIFDVDGSCD
SPNLQPCSSRALSNFRAVVNSFRGIYGINAGIKNNSGIAVGRYAEDIYQGGNPWYLITTA
AAEFLYDAVAQWKNQKALTVDSISINFFRDLYPTIKLKSYTNKDNEFTKILNAITTYADS
FVTVAQKYTPVDGSLAEQFDRNTGTPISANDLTWSYAAFVTMAQRRSGQYPASWGSSASS
IPPPNCAPSSTQGVYIPAIAAGAPNITATCKYAVQFYVNATTYYGENIYVIGNTTDLGNW
DLNSALPMNAGMYTTEYPLWYVDTKLTAGDTVSYVFVRQQDCGQAPIYESGNRTVTVPEC
GTGGTKVVRAAWAGSVGSSGSC
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcggttttattcagtcacagcagttttatctctgctatgtactcaagcaatagcgact
tcaccaagcgattcggctgcaagttataataatctcaattcattcattgcttccgagaga
aaaattgctttacaaggcgttctcaataatattggaccagatggatcaaaagtgtcagga
gcaggcaactatgttgttgcaagtccatctaaagctaatccggattgtgagagcaacatt
ctcgatttctacacctggacacgagactccgcattgacgttaaagatgattgttgatgaa
tttatctttggcaatcgtgcacttcaacctcagattgagaaatatgtaaaggctcaagct
atcctccaaactgttacgaatccttctggttctcttctttatgacggtcttggtctcggt
gaaccaaaatataaggttgatggtacccaattcaatggtgcatggggtagacctcaacgt
gatggcccagctcttcgtgctattgctttaatggcttatagtaattggttgataaatcat
gatcaatttcaaagagccaagctagttatatggcctattatttcaaatgatctttcgtac
atcggggagtactggaactcaactgggttcgacctctgggaagaagaacttggctcaagc
ttcttcaccttacagaatcagcatcgtgcttttattgaaggtcaaactttggctaataag
ctgggagttgaatgtacaggatgtcttaatgcacccgaagtcctttgttttctctctcaa
agtttttggaatggtgaatatatcatctcaaatgttaatgtggataatggaaggactgga
ttagatgcaaattctatccttggttcaatatctattttcgatgttgatgggtcatgtgat
agtccaaatttacaaccttgtagtagcagagcgttgtcaaactttagggctgttgtcaat
agctttcgagggatttatggtatcaatgctggtattaagaataattcaggtattgctgtt
ggaagatatgctgaagatatttatcaaggaggaaatccatggtatttaatcaccactgct
gccgcagaatttctctatgatgctgttgcacaatggaaaaatcagaaagccctgaccgtt
gactcgatatccatcaacttcttccgcgatctctatccaaccatcaagcttaaaagctat
accaacaaggacaacgaatttaccaaaatactgaacgctattacaacatatgccgattct
ttcgtcacagtcgcgcaaaaatacacacccgtagatggatctctagctgaacaattcgat
cgcaatactggcacccccatctcggcaaatgacctaacatggagttacgcagcattcgtc
acaatggcccaaagacgttctggtcaatatcccgccagctggggaagttcagcatcatca
atcccaccaccaaactgcgcaccttcatcaactcaaggcgtatacattccagccattgca
gcaggcgccccaaacatcacagcaacatgtaaatacgcggttcaattctacgtcaacgct
acaacatattatggcgaaaatatatatgtcattggtaacacgacggatctcgggaattgg
gatttaaatagcgcgttgccgatgaatgcggggatgtatacgacggaatatccattatgg
tatgtggatacgaagctgacggcgggcgatacggttagttatgtttttgttagacagcag
gattgtggtcaagctccgatttatgagagtgggaataggacggttacggttccggaatgt
gggactggagggacgaaggtggttagggctgcttgggctgggagtgtggggagtagtggg
agttgttga

DBGET integrated database retrieval system