KEGG   Sclerotinia sclerotiorum: SS1G_13859Help
Entry
SS1G_13859        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ssl  Sclerotinia sclerotiorum
Brite
Enzymes [BR:ssl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SS1G_13859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 506 aa AA seqDB search
MTGPSQDKDSNVGTPAPKQKSKATIDTLRVGCIAMVQKDGALRRAEILSIKETKSGRQFY
CNFDNFNKRLDEWVPAIRIDFTQDVEWPAPEKPKDKSKAAPAGKKTSVGKKKNQKRPAQA
SKREDSVISESGSNAQPWSEFADSQRQTPDVDGDGDAKLTVALDLDATPEANDPMDVDEA
AAEAANAKNEPVQHFSREEEIEKLRTGGSMTQNQAEISRIRNISKVQFGKFDLYPWYFSP
YPEVFTQEDLMYICEFCLSYYGDLKSFTRHRHKCTLQHPPGNEIYRDDYVSFFEIDGRRQ
RTWCRNLCLISKMFLDHKTLYYDVDPFLFYVMCSVDEKGFHLVGYFSKEKESADGYNVAC
ILTLPQYQRKGYGRLLINFSYELSKIEGKLGSPEKPLSDLGLLSYRQYWTERIVEELLIH
NERDERISIEGLSQKLSMTSADVEHTLQALKMQVYHKGEHKMVLPTALIKRHEAMREKYK
LRPKRVIDPARIVWKPFKLVDRTWGW
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtccttcacaggataaggatagtaatgtaggaacaccggcacctaaacagaag
agtaaagcgacgattgatactttgagggtaggatgtatagctatggttcagaaggatggt
gcacttagaagagcagaaattctaagtataaaagagacgaaaagtggtcgtcaattttat
tgcaattttgacaatttcaataaacgtctagatgaatgggttccagctatacgaatagat
tttactcaagatgttgaatggccagctccagaaaaaccaaaggataaatccaaagctgct
ccagctggaaagaaaaccagcgtgggtaagaagaagaatcaaaaacgtccagcgcaagca
agtaaaagagaagattccgtcatttcagaatcaggttcaaatgctcaaccttggtcggaa
tttgctgattctcaaagacaaactcctgatgttgatggagatggagatgcaaaacttacc
gtggcattagatcttgatgctactcctgaagcaaatgatcctatggatgtggatgaagcg
gcagctgaagcagcaaatgcgaagaatgaacccgttcaacatttcagtcgagaagaagaa
attgaaaagttaagaactggaggttccatgacacaaaatcaagccgaaatatcacgaatt
cgaaatatttccaaagttcaattcggtaaattcgacctttacccttggtatttctctcct
tatccagaagtcttcactcaagaggatctaatgtacatttgtgaattttgtttatcttat
tacggagatctcaaatcgtttactcgacatcgtcacaagtgtacattacaacatcctcct
ggaaatgaaatctatcgagatgattacgtttcattcttcgaaattgatggtcgtcgtcaa
cgaacttggtgtcgaaacttatgtctcatatcgaagatgtttctcgatcacaaaactctt
tactacgatgtggatcctttcctcttctatgtcatgtgttccgtagacgaaaagggattt
catctcgtaggatatttttcaaaagagaaagaaagcgcagatggatacaatgtagcttgt
atcctcacacttccccaataccaacgtaaaggatacggacgtctcctcatcaatttctcc
tacgaactttccaaaatcgaaggaaaactcggctctcccgaaaaacccctctcggatctc
ggtctcctctcctatcgacaatactggaccgaacgcatcgtcgaggaactcttaatccac
aacgaaagagatgaaagaataagcatagaaggtctatcccaaaaacttagcatgacgagc
gcagatgtggaacatacgttacaagcgttgaaaatgcaggtttatcataagggggaacat
aagatggttttaccgacggcgttgattaagagacatgaggcgatgagggagaaatataag
ttgagaccgaagagggtgattgatcccgcgaggatcgtgtggaaaccgtttaaattggtg
gataggacttgggggtggtag

DBGET integrated database retrieval system