KEGG   Sclerotinia sclerotiorum: SS1G_14074Help
Entry
SS1G_14074        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00010  Glycolysis / Gluconeogenesis
ssl00020  Citrate cycle (TCA cycle)
ssl00620  Pyruvate metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01130  Biosynthesis of antibiotics
ssl01200  Carbon metabolism
Module
ssl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SS1G_14074
   00020 Citrate cycle (TCA cycle)
    SS1G_14074
   00620 Pyruvate metabolism
    SS1G_14074
Enzymes [BR:ssl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SS1G_14074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GREB1
Motif
Other DBs
NCBI-GeneID: 5481044
NCBI-ProteinID: XP_001584977
UniProt: A0A1D9QE32 A7F8Z3
AA seq 463 aa AA seqDB search
MFSAVLRRRALQSSSLPYQLARCYASKSFPPHTVVTMPALSPTMTAGNIGSWQKKPGDSI
VPGDVLVEIETDKAQMDFEFQEEGVLAAILKQSGEKDVAVGNPIAVMVEEEGDVSAFADF
TLADAGGEKAAPAPPKEEASQSSEKSDTKSGTAPPPPTESTPAPEESASSGGRLQPAMDR
AINASSAAIKLALDTGVKLTGVKGTGLGGQITEADVKKASSGASTGSAPAAATSTYVDTP
ITSMRKTIANRLTESVNQNPHYFVASTVSVTKLIKLRAALNASGEGKYKLSINDFLIKAC
AIACKKVPAVNSSWRDGFIRQFSNVDVSVAVATPVGLMTPIVKNVEGLGLESISAQVKDL
GKRARDGKLKPDEYQGGTFTISNMGMNSAIDRFTAVINPPQAAILAVGTTQKAAIQGADG
GIEWDDQITVTGSFDHKVVDGAVGGEWMKEFKKVVENPLELLL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgttttccgcagtgttgagaaggcgtgctcttcaatcatcatctctgccatatcaatta
gcaagatgttatgcttcgaaatcattccctcctcataccgtggtcactatgccagcttta
tcgccaacaatgactgcaggtaacattggatcatggcaaaaaaagcctggagattcaatt
gtccctggtgatgtcttggtagagattgagactgataaggcgcaaatggatttcgagttc
caagaggagggtgttttggctgccattttgaagcagtctggtgagaaggatgtcgctgtt
ggaaatccaatcgctgttatggttgaagaggaaggggatgtatcggctttcgcggacttc
acactcgcagatgccggaggagagaaggctgcgccagcaccacccaaggaggaagccagc
caatcttccgagaaatctgacacaaaatctggaactgctcccccgcccccaactgagtcg
actccagccccagaggaatccgcatcgagtggtggaagattacaacctgctatggacaga
gcaatcaatgctagctctgcggctattaaattggcacttgacaccggtgttaagcttact
ggcgttaagggtactggactcggtggacaaattactgaggcagatgttaagaaggcttcc
tccggagcctccaccggcagcgcaccagcagctgctacatccacttacgttgatacccca
atcacatccatgcgtaagaccattgccaaccgtcttaccgagtctgtgaaccaaaaccca
cactactttgtcgcctctaccgtttccgttaccaagctcatcaagctccgcgcagctctc
aacgcctctggagaaggaaaatataagctctcaatcaacgacttcttgatcaaggcctgt
gctattgcatgcaagaaggtcccagctgttaactccagctggagagatggtttcatccgt
caatttagcaatgttgatgttagcgttgctgttgctaccccagtcggtcttatgacacca
atcgtcaagaacgttgaaggactcggtctggaatccatctcagcacaagtcaaggatctt
ggcaagcgtgcccgtgatggcaaactcaagccagatgaataccaaggtggaactttcaca
atcagcaacatgggaatgaacagcgccatcgacagattcacagctgttatcaacccacca
caagcagccatcctcgctgtaggaaccacccaaaaggcagctatccaaggcgcagacgga
ggaatcgaatgggatgaccaaatcaccgttactggaagcttcgaccacaaggtcgttgat
ggtgccgttggtggtgaatggatgaaggagttcaagaaggttgtagagaaccccttggag
ttactgctataa

DBGET integrated database retrieval system