KEGG   Sclerotinia sclerotiorum: SS1G_14074Help
Entry
SS1G_14074        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ssl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ssl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ssl00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 463 aa AA seqDB search
MFSAVLRRRALQSSSLPYQLARCYASKSFPPHTVVTMPALSPTMTAGNIGSWQKKPGDSI
VPGDVLVEIETDKAQMDFEFQEEGVLAAILKQSGEKDVAVGNPIAVMVEEEGDVSAFADF
TLADAGGEKAAPAPPKEEASQSSEKSDTKSGTAPPPPTESTPAPEESASSGGRLQPAMDR
AINASSAAIKLALDTGVKLTGVKGTGLGGQITEADVKKASSGASTGSAPAAATSTYVDTP
ITSMRKTIANRLTESVNQNPHYFVASTVSVTKLIKLRAALNASGEGKYKLSINDFLIKAC
AIACKKVPAVNSSWRDGFIRQFSNVDVSVAVATPVGLMTPIVKNVEGLGLESISAQVKDL
GKRARDGKLKPDEYQGGTFTISNMGMNSAIDRFTAVINPPQAAILAVGTTQKAAIQGADG
GIEWDDQITVTGSFDHKVVDGAVGGEWMKEFKKVVENPLELLL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgttttccgcagtgttgagaaggcgtgctcttcaatcatcatctctgccatatcaatta
gcaagatgttatgcttcgaaatcattccctcctcataccgtggtcactatgccagcttta
tcgccaacaatgactgcaggtaacattggatcatggcaaaaaaagcctggagattcaatt
gtccctggtgatgtcttggtagagattgagactgataaggcgcaaatggatttcgagttc
caagaggagggtgttttggctgccattttgaagcagtctggtgagaaggatgtcgctgtt
ggaaatccaatcgctgttatggttgaagaggaaggggatgtatcggctttcgcggacttc
acactcgcagatgccggaggagagaaggctgcgccagcaccacccaaggaggaagccagc
caatcttccgagaaatctgacacaaaatctggaactgctcccccgcccccaactgagtcg
actccagccccagaggaatccgcatcgagtggtggaagattacaacctgctatggacaga
gcaatcaatgctagctctgcggctattaaattggcacttgacaccggtgttaagcttact
ggcgttaagggtactggactcggtggacaaattactgaggcagatgttaagaaggcttcc
tccggagcctccaccggcagcgcaccagcagctgctacatccacttacgttgatacccca
atcacatccatgcgtaagaccattgccaaccgtcttaccgagtctgtgaaccaaaaccca
cactactttgtcgcctctaccgtttccgttaccaagctcatcaagctccgcgcagctctc
aacgcctctggagaaggaaaatataagctctcaatcaacgacttcttgatcaaggcctgt
gctattgcatgcaagaaggtcccagctgttaactccagctggagagatggtttcatccgt
caatttagcaatgttgatgttagcgttgctgttgctaccccagtcggtcttatgacacca
atcgtcaagaacgttgaaggactcggtctggaatccatctcagcacaagtcaaggatctt
ggcaagcgtgcccgtgatggcaaactcaagccagatgaataccaaggtggaactttcaca
atcagcaacatgggaatgaacagcgccatcgacagattcacagctgttatcaacccacca
caagcagccatcctcgctgtaggaaccacccaaaaggcagctatccaaggcgcagacgga
ggaatcgaatgggatgaccaaatcaccgttactggaagcttcgaccacaaggtcgttgat
ggtgccgttggtggtgaatggatgaaggagttcaagaaggttgtagagaaccccttggag
ttactgctataa

DBGET integrated database retrieval system