KEGG   Sclerotinia sclerotiorum: SS1G_14149Help
Entry
SS1G_14149        CDS       T01071                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SS1G_14149
Enzymes [BR:ssl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     SS1G_14149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 797 aa AA seqDB search
MNSPPDPNSATVPRRPALRTDSEDLNSPKSGPTKVVSIAEPEPEDVQKFELPPSDESSKT
KHFSAGVAKRMTGRPNMPSATSSKLSIRSQTSFEEPIRETRTSDFSKPTDDSKHHHHRDK
LLSQVAEWLHAEKAKRATRESNKRGTKENEAEVEDLSGRGTSSKPRSMSSSSSSSALSLE
KLQKILEDNMLDLGHSHLPHLTPPRRVSRKRSLVRPSLKPTPSSDTEYHDEDIVVPSCDV
ILDNSKTLAYSGGAGSSMETTTLSNSKRAEKERKAWIQFKNEIVRLAHTLRLKGWRRVPL
DRGAEIEVERLSGALTNAVYVVSPPANLPPSASSTNLSTKSQRYPSKLLLRIYGPQVEHL
IDREAELSILRRLARKKIGPRMLGTFRNGRFEEFFNAQTLTAQDLRIPDTSKKIAKRMRE
LHDGVALLQEERDQGPFVWRNWDKWVDRCEKIITYLDRQILDGDSSRSIRGESWRDRGLV
CGVEWPVFRAAVERYRQWLEKYYGGSEELSRSLVFAHNDTQYGNILRLVPELPVDGSAPS
PLLLPMNHHKQLVVIDFEYASANTRGLEFANHFTEWCYNYHAPPPMTWTCDTRNYPTIEE
QKRFIRAYINHRPHFNLHAYSTPKFEGRDAPAGSIKEFMLDSRTLASERDMPSSSTNLYA
EEEARREEETEKQVEEMLREVRMWRLANSAQWVAWGIVQAKVPELDDAPPFVVTPDEIDG
PQNGILEDAKMDDKMERENEREIKVKEQVEEEEDEFDYLGYAQSRALFFWGDVVALGILG
IDELPVELADRIKILNY
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaccaccagatcccaacagtgcgacggtgcctcgcagaccagcattaaggaca
gattcggaagaccttaatagccccaagagtggaccaaccaaagtcgtttcaattgccgag
ccagaaccagaagacgtacaaaaatttgaacttcctccgtccgacgaatcttcaaagaca
aaacatttcagtgctggtgttgcgaaaagaatgacaggtcgaccaaatatgccttctgca
acttcctctaaactttctatccggagtcaaaccagcttcgaggaaccaattcgagagact
cgtacctccgatttttcaaagcccactgatgattcaaagcaccatcaccaccgcgacaaa
cttctctctcaagtcgcagaatggctgcatgcagagaaagcgaagagggctacccgggaa
tcaaataagaggggcaccaaggagaatgaggctgaggttgaggatttgtcaggtagagga
acaagttcaaaaccaagatcaatgtctagcagttcatcttcaagcgctctttccttggaa
aaattgcaaaaaattttggaggataacatgttagatcttggtcacagtcaccttccgcac
cttacacccccgagacgagtttcaagaaaacgatctctcgtacgcccttcgctgaaacct
actccatcctctgacaccgaataccatgatgaggacattgtagtcccatcgtgtgacgtg
attcttgataattcaaaaacacttgcatatagtggtggtgctgggtcttccatggaaaca
actacattaagtaattccaaacgagccgagaaggagaggaaagcatggattcaatttaag
aatgaaattgtgagattggcgcacacattaagattgaaaggttggagaagagttccatta
gaccgaggagctgaaatcgaagtggaaagattgagtggtgctctcacaaacgcggtttat
gttgtttctcctccagcaaatctaccaccgtctgcgagcagtaccaatctttctactaag
agccaaagatatccatcaaagttattgcttcgaatttatggtcctcaagttgagcaccta
attgatagagaagcggaactgagcattttgaggagattagctaggaagaaaattggacct
agaatgttgggtacttttcgaaatggtcgatttgaagaattctttaatgctcaaaccctc
acggctcaagacctcagaattcccgacacgagtaagaaaattgcgaaacgtatgagggaa
ttacatgatggtgtcgcattgttgcaagaagaaagagaccaaggaccattcgtttggaga
aattgggacaaatgggtcgatagatgtgagaaaattatcacctatctcgaccgacagatt
ttagacggggactctagtagaagtattagaggcgaaagttggagagatagaggattagtt
tgtggtgttgaatggcccgtcttcagagctgctgttgaaagataccgacaatggttagag
aaatattatggtggaagtgaggaattaagccgtagtttagtttttgctcataatgataca
caatatggcaacatcttacgcttagtacccgaactacccgtcgatggatccgcaccttct
ccacttctacttcctatgaatcatcacaaacaactagtagtcattgattttgagtatgca
agtgccaatacccgtggcttggaattcgccaatcattttaccgaatggtgttacaattat
catgcacctcctccaatgacttggacgtgcgacaccagaaattatccaactattgaagaa
caaaagagattcatcagagcatatataaatcatcgccctcactttaacttacatgcttac
tctactccaaagttcgaagggcgggacgctccggcgggcagtattaaagagtttatgtta
gatagtcggacgcttgctagtgaaagggacatgcctagtagcagtacgaatctctacgcg
gaagaagaagcaagaagagaggaagaaaccgaaaagcaagtcgaggaaatgttgagagaa
gttaggatgtggagattagctaatagtgcacaatgggttgcgtggggaattgtacaagct
aaggtaccagaattggatgatgcgccgccttttgttgtaacaccggatgaaattgatggg
cctcaaaatggcattttggaagatgcgaagatggatgataagatggagagagaaaatgag
agagagatcaaagtgaaagaacaagtggaggaggaagaggatgaattcgattatctggga
tatgcgcaaagtagagcgcttttcttctggggagatgtggtggcattggggattttggga
atagacgagttacctgtggagttggctgatcggatcaaaattttgaattattaa

DBGET integrated database retrieval system