KEGG   Sclerotinia sclerotiorum: SS1G_14461Help
Entry
SS1G_14461        CDS       T01071                                 

Definition
tyrosinase precursor
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SS1G_14461
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SS1G_14461
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     SS1G_14461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 672 aa AA seqDB search
MAAVPALNYPITGPPKASPGPADGSVPLRREIRDLQRNFPDQWTLYILGLQAFQQLDEKS
DLSWYGIAGIHGRPYRPWGGSQGDNSPGWQGYCTHSSILFAPWHRPYLALFEQYLYQIIQ
KIASTFPTATKTRYQQAALTFRMPYWDWAAAPPAGDKYFPTVVGQPLIQLITPTSNNKPV
QITNPLYSYKFNPLNPLKGDFPSTPESRWPSTLRYPTTGSATANSQEQQVFDAMESQFDS
YQSNIYLIMRDPNYKQFDAFSNHQWAANNAPGTYGSIEDVHNSVHSETGGNGHMGDPDYA
AFDPLFWLHHTNVDRQFAIWQALNPNSYAINKPSSDGTFSIESGAQETSTTALTPFNNAT
GKTYWTSDGVRSTATFNYAYPETQQWKFPTVQQYQTSVLAAVQKLYGATSNQFMQLMGVQ
TAAASGPIAVQASQIVADGSNTAQKPIGDGAASSSGEHKFLSNLLHNSAKAKPKPVDVVR
GEEDFESEIGKPSETSSKSVEPIKYREYIVNIRAPKHILHQTYRVRIFLGDFDSDPTTWP
TAESTIGTFSSFGKNPATTSCGKCIKDAARSLMISGTVPLTPILLKLFKSGDLGSLEVEN
VIPYLRRNLHWRVTLADGTEIDRGEVEGLKVSVVSTVVGCPQGAFPEFSGVYEVHSEVTG
GRPAGLSEGDRV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagtcccggcactcaactaccccatcactgggcctccaaaagcttctccaggt
cctgctgatggatctgtccctctgagacgtgaaattcgtgacctccaacgcaactttccc
gatcaatggacactttacattcttggtcttcaggcttttcaacaacttgacgagaagtca
gatttgtcatggtatggaatcgctggtattcatggacgtccatatcgtccttggggtgga
tctcaaggagataactctcctggatggcaaggctattgcacccatagctctatcctcttt
gcgccatggcatcgtccttatcttgcattattcgagcaatacctctatcaaattatacaa
aaaattgcttctacattccccacagccactaagactcgttatcaacaagcggctctaaca
tttcgcatgccatactgggattgggctgccgcaccacctgcgggtgacaagtactttcct
actgttgttggacagcccttgattcagctcattactcccacctcaaataacaaaccggta
caaatcaccaaccccctttactcttacaaattcaaccccttgaatccgttgaagggtgat
tttcctagtaccccggaatcacgatggcccagcactcttcgatatccaaccaccggaagt
gcaactgccaactcccaagaacagcaagtctttgacgccatggagtcacaatttgattca
tatcaaagcaatatctatctcatcatgagagatccaaactataagcaatttgatgctttt
agtaatcatcaatgggcagcaaataatgctcctggtacgtatggtagtattgaggatgtg
cataatagtgttcacagtgaaactggtgggaatggtcatatgggtgatcctgattatgcg
gcttttgatcctttgttttggttacatcataccaatgttgatcgtcaatttgctatttgg
caagccttgaatcccaatagctacgccatcaacaaaccttctagcgatggaaccttttcc
atcgaaagcggtgcccaagaaacaagtaccactgccttgacacctttcaacaatgccact
ggcaaaacatattggacctctgacggcgtgcgcagcacagctacatttaactatgcgtat
ccagagacccaacaatggaaatttcctactgttcaacagtatcaaaccagtgtcttagca
gcagttcaaaaattgtacggtgctactagtaaccaattcatgcaattgatgggtgtacag
actgctgctgcctctgggcccattgctgttcaagcaagccaaatcgttgcagatggcagt
aatacagctcagaaacctattggcgatggtgctgcttcatcatctggtgaacacaaattt
ttatcaaatcttcttcacaattctgccaaagctaaacctaagcccgttgacgtagtgaga
ggtgaagaggactttgaatccgagattgggaaaccatccgaaacttcttcaaaaagcgta
gaaccaattaaatatagagaatatattgtcaatatccgtgctccgaagcatattctccat
caaacctatcgcgtgcgaattttcctcggagatttcgattcagatcctactacatggcca
accgccgaatctacaatcggcaccttttcctcctttggcaaaaaccccgccaccacctcc
tgcggaaaatgcatcaaagacgccgcacgctccctcatgatctcgggaaccgtccctctc
acccccatcctccttaaactcttcaagtccggcgatctaggatcgctagaagtcgaaaat
gtcattccgtatttgagacggaatttgcattggagagttacgttggcggatggtacggag
attgataggggagaggtggaggggctgaaggttagtgtggttagtactgtggttgggtgt
ccacagggggctttcccggagtttagtggggtttatgaggttcatagtgaggttacgggg
ggacggccggcggggttgagtgagggggatagggtttga

DBGET integrated database retrieval system