KEGG   Sclerotinia sclerotiorum: SS1G_14461Help
Entry
SS1G_14461        CDS       T01071                                 

Definition
tyrosinase precursor
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ssl00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:ssl00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 672 aa AA seqDB search
MAAVPALNYPITGPPKASPGPADGSVPLRREIRDLQRNFPDQWTLYILGLQAFQQLDEKS
DLSWYGIAGIHGRPYRPWGGSQGDNSPGWQGYCTHSSILFAPWHRPYLALFEQYLYQIIQ
KIASTFPTATKTRYQQAALTFRMPYWDWAAAPPAGDKYFPTVVGQPLIQLITPTSNNKPV
QITNPLYSYKFNPLNPLKGDFPSTPESRWPSTLRYPTTGSATANSQEQQVFDAMESQFDS
YQSNIYLIMRDPNYKQFDAFSNHQWAANNAPGTYGSIEDVHNSVHSETGGNGHMGDPDYA
AFDPLFWLHHTNVDRQFAIWQALNPNSYAINKPSSDGTFSIESGAQETSTTALTPFNNAT
GKTYWTSDGVRSTATFNYAYPETQQWKFPTVQQYQTSVLAAVQKLYGATSNQFMQLMGVQ
TAAASGPIAVQASQIVADGSNTAQKPIGDGAASSSGEHKFLSNLLHNSAKAKPKPVDVVR
GEEDFESEIGKPSETSSKSVEPIKYREYIVNIRAPKHILHQTYRVRIFLGDFDSDPTTWP
TAESTIGTFSSFGKNPATTSCGKCIKDAARSLMISGTVPLTPILLKLFKSGDLGSLEVEN
VIPYLRRNLHWRVTLADGTEIDRGEVEGLKVSVVSTVVGCPQGAFPEFSGVYEVHSEVTG
GRPAGLSEGDRV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagtcccggcactcaactaccccatcactgggcctccaaaagcttctccaggt
cctgctgatggatctgtccctctgagacgtgaaattcgtgacctccaacgcaactttccc
gatcaatggacactttacattcttggtcttcaggcttttcaacaacttgacgagaagtca
gatttgtcatggtatggaatcgctggtattcatggacgtccatatcgtccttggggtgga
tctcaaggagataactctcctggatggcaaggctattgcacccatagctctatcctcttt
gcgccatggcatcgtccttatcttgcattattcgagcaatacctctatcaaattatacaa
aaaattgcttctacattccccacagccactaagactcgttatcaacaagcggctctaaca
tttcgcatgccatactgggattgggctgccgcaccacctgcgggtgacaagtactttcct
actgttgttggacagcccttgattcagctcattactcccacctcaaataacaaaccggta
caaatcaccaaccccctttactcttacaaattcaaccccttgaatccgttgaagggtgat
tttcctagtaccccggaatcacgatggcccagcactcttcgatatccaaccaccggaagt
gcaactgccaactcccaagaacagcaagtctttgacgccatggagtcacaatttgattca
tatcaaagcaatatctatctcatcatgagagatccaaactataagcaatttgatgctttt
agtaatcatcaatgggcagcaaataatgctcctggtacgtatggtagtattgaggatgtg
cataatagtgttcacagtgaaactggtgggaatggtcatatgggtgatcctgattatgcg
gcttttgatcctttgttttggttacatcataccaatgttgatcgtcaatttgctatttgg
caagccttgaatcccaatagctacgccatcaacaaaccttctagcgatggaaccttttcc
atcgaaagcggtgcccaagaaacaagtaccactgccttgacacctttcaacaatgccact
ggcaaaacatattggacctctgacggcgtgcgcagcacagctacatttaactatgcgtat
ccagagacccaacaatggaaatttcctactgttcaacagtatcaaaccagtgtcttagca
gcagttcaaaaattgtacggtgctactagtaaccaattcatgcaattgatgggtgtacag
actgctgctgcctctgggcccattgctgttcaagcaagccaaatcgttgcagatggcagt
aatacagctcagaaacctattggcgatggtgctgcttcatcatctggtgaacacaaattt
ttatcaaatcttcttcacaattctgccaaagctaaacctaagcccgttgacgtagtgaga
ggtgaagaggactttgaatccgagattgggaaaccatccgaaacttcttcaaaaagcgta
gaaccaattaaatatagagaatatattgtcaatatccgtgctccgaagcatattctccat
caaacctatcgcgtgcgaattttcctcggagatttcgattcagatcctactacatggcca
accgccgaatctacaatcggcaccttttcctcctttggcaaaaaccccgccaccacctcc
tgcggaaaatgcatcaaagacgccgcacgctccctcatgatctcgggaaccgtccctctc
acccccatcctccttaaactcttcaagtccggcgatctaggatcgctagaagtcgaaaat
gtcattccgtatttgagacggaatttgcattggagagttacgttggcggatggtacggag
attgataggggagaggtggaggggctgaaggttagtgtggttagtactgtggttgggtgt
ccacagggggctttcccggagtttagtggggtttatgaggttcatagtgaggttacgggg
ggacggccggcggggttgagtgagggggatagggtttga

DBGET integrated database retrieval system