KEGG   Spirochaeta smaragdinae: Spirs_0086Help
Entry
Spirs_0086        CDS       T01287                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ssm  Spirochaeta smaragdinae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(90683..91270)
Genome map
AA seq 195 aa AA seqDB search
MNQLERLIRSLSRLPGVGRKSAARIAHYLLKADSAFVTRLAEEIGTLKERIHPCPVCGNF
TEDELCSVCSDPRRDGTQICVVEEPQDVATIESTGEYNGLFHVLGGAINPMNGVGPSDLS
IDKLVKRASEGTVKEIIIATNPTVEGDTTALYLQNILKERPIEVSRLASGLPVGGDLEYA
DKLTLARSFRGRTKL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagttggagcgactcatccgaagcctttccaggttaccgggtgtgggaagaaag
agtgccgcgcgaattgcccattaccttctcaaagccgattcggcctttgttacacggctt
gcggaagagattggcacactaaaagaacgcatacatccctgccctgtctgcggaaacttc
accgaggatgaactctgttccgtctgttctgatcctcgtcgggatggaacacagatctgt
gtggtggaagagcctcaggatgtggcgaccatcgaatcgacaggggagtataacggcctt
tttcacgttcttggtggagcaatcaatccgatgaatggagtcgggccgagcgatctttcc
attgataagctggtcaaacgggcatccgaaggtacggtgaaggaaattatcatcgcaacc
aatccgacagtcgagggagataccaccgcactctaccttcagaacatcttaaaggaacgc
cccattgaagtcagccgcctggcatccggactgccggtaggcggtgacctcgaatatgcg
gacaagcttacccttgcccgctccttccggggacgaacgaaactgtaa

DBGET integrated database retrieval system