KEGG   Spirochaeta smaragdinae: Spirs_0086Help
Entry
Spirs_0086        CDS       T01287                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ssm  Spirochaeta smaragdinae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Spirs_0086
DNA repair and recombination proteins [BR:ssm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Spirs_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(90683..91270)
Genome map
AA seq 195 aa AA seqDB search
MNQLERLIRSLSRLPGVGRKSAARIAHYLLKADSAFVTRLAEEIGTLKERIHPCPVCGNF
TEDELCSVCSDPRRDGTQICVVEEPQDVATIESTGEYNGLFHVLGGAINPMNGVGPSDLS
IDKLVKRASEGTVKEIIIATNPTVEGDTTALYLQNILKERPIEVSRLASGLPVGGDLEYA
DKLTLARSFRGRTKL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagttggagcgactcatccgaagcctttccaggttaccgggtgtgggaagaaag
agtgccgcgcgaattgcccattaccttctcaaagccgattcggcctttgttacacggctt
gcggaagagattggcacactaaaagaacgcatacatccctgccctgtctgcggaaacttc
accgaggatgaactctgttccgtctgttctgatcctcgtcgggatggaacacagatctgt
gtggtggaagagcctcaggatgtggcgaccatcgaatcgacaggggagtataacggcctt
tttcacgttcttggtggagcaatcaatccgatgaatggagtcgggccgagcgatctttcc
attgataagctggtcaaacgggcatccgaaggtacggtgaaggaaattatcatcgcaacc
aatccgacagtcgagggagataccaccgcactctaccttcagaacatcttaaaggaacgc
cccattgaagtcagccgcctggcatccggactgccggtaggcggtgacctcgaatatgcg
gacaagcttacccttgcccgctccttccggggacgaacgaaactgtaa

DBGET integrated database retrieval system