KEGG   Spirochaeta smaragdinae: Spirs_0159Help
Entry
Spirs_0159        CDS       T01287                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Spirs_0159
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spirs_0159
   00600 Sphingolipid metabolism
    Spirs_0159
Enzymes [BR:ssm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Spirs_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
162200..164248
Genome map
AA seq 682 aa AA seqDB search
MNTSWSILFSYHLGSEEFELGGLSGGATFADGVRIVVEQRKLPLGERILFHAEPAPGGEG
LFPVAERLELRLRCSSCEAVFLNGYQSWTESRELEAEVFPFRFRRLFRPWINHYLLDRYG
DACFTGRSFSKKRYHGCSFATLRKGKQVTLLAGMIEDRALSRIEWRSERRGRGYLSFLPE
LSSNKISGVRTLMDLVVLTGEEEAVYEGWASAADGFGPVEPGESLSGWTSWYDHYEKVTE
ADVLRVLDSWQRLSLPPGVIQIDDGWQQAVGDWLRVKPTFPRGMAPLAADISKAGMEPGL
WVAPFIAEGSSLLFAEHRDWFLTDDAAEPLAAGNNPFNWSGYFYALNIYHPEVKTYLRTL
FSTIVKQWGFRFLKLDFLYAAALRLPEGKTRGEVMRDAVAFLREISGEAKLLGCGVPLAS
AAGLVEYCRVGADVALRWEDRRLRALGYPERVSTLNALRSTISRRGLDGRFFLNDPDVFL
LRDWNSDLNEQERFTLFLCNHIFGSLLFTSDDPGRYDEATLALFRSGYPLRKKHGLRMNR
IGECFEIEFSIGTLCYLAFINLENRPHHVTLASGLYYAYGEGFRREGPLDLRPHQSICFL
VVGETDFAVAGSTGMLFPGSEVERIDVDGEHVTLSLAPGTLSEGLLFFRAPQGASGCSIN
GIDIEAEEKVGLRLCVVEKRLL
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacctcctggtcgattcttttttcgtatcatctcggctcggaagaattcgagtta
ggtggcttaagcggtggtgccacctttgccgacggagtccgcatcgtcgttgagcagaga
aaacttccattgggagagcgtattcttttccatgccgagccggctcccgggggggagggg
cttttccctgtggccgaacgtttggagcttaggttacggtgttcctcctgtgaagcggtt
tttctcaacggctatcaaagctggaccgagagcagggaactggaggcagaggttttcccg
tttcgatttcggcgcttgtttcgtccctggatcaatcactaccttctcgaccgctatggt
gatgcatgctttaccggtcgttccttttcaaaaaagcgatatcatggatgttcttttgcc
acgcttcgtaaaggaaagcaggtgacattgctcgccgggatgattgaggatagagccctc
tctcgaatcgagtggagatcggagcgccgtggtcgtggatacttgagttttctgcccgag
ctctccagtaataaaatcagtggtgttcgaaccttgatggatcttgttgtactgacagga
gaggaagaggccgtctatgaaggttgggcctcggcagccgacggtttcggacccgtggag
cctggtgagagcctgagcggttggaccagctggtacgaccactacgaaaaggtgacggag
gcggatgtactgagagtgcttgattcatggcagcggctttcgcttcctcccggagttatc
caaatagatgatggatggcagcaggctgtcggtgactggctgcgtgtcaagccgactttt
ccccgcggaatggcccccctcgccgccgatatttccaaggccgggatggaacctgggctt
tgggtggcgccctttattgcagagggctcttccctgctttttgccgagcatcgcgactgg
tttctcaccgatgacgctgcagaacctcttgccgcgggtaataatcctttcaattggagt
ggctatttttatgccctgaatatctatcaccctgaagtgaagacgtatcttcgtacgctc
ttctcgacaattgtgaaacagtggggctttcgtttccttaagcttgattttctttatgct
gcggctcttcgcctgcccgaaggaaagaccagaggagaggtgatgcgggatgccgtggcg
ttccttcgtgagatctccggtgaagccaagctcttgggctgcggggttcctcttgcttcc
gcagccgggcttgttgaatattgcagagttggggcagatgtggcactgcgctgggaagac
cgtcggctacgggccctcggttatcctgagcgtgtttccaccctcaatgccttacgcagc
accatctcccgcaggggcttggacggtcggttttttcttaatgatcccgatgtttttctg
ctccgggactggaattctgacctgaatgagcaggaacgttttacccttttcctttgcaat
catatatttggctctttgctttttaccagcgacgatcccggccgctatgacgaggcgacg
cttgccctgtttcggtcgggatatcctcttcgaaagaagcatggccttcggatgaaccgg
ataggagagtgcttcgagattgaattctctatcggtaccctttgctatcttgcctttatt
aatcttgagaatcgacctcatcatgttaccttggcttccgggctgtactatgcatatggc
gaagggtttcggcgggaaggccctcttgacctgcgtcctcatcaatcgatctgttttctc
gttgttggtgaaaccgattttgccgttgctggttctaccggcatgcttttccccggtagt
gaagtcgaaaggatagatgtggatggagagcacgtgacgctttcccttgctcccgggacc
ctatccgaggggctgctcttctttcgggcccctcagggggccagtggttgcagtatcaat
ggtatcgacatagaggcggaagagaaggtcggccttcgtctctgtgtagttgaaaaacgt
ctcctatag

DBGET integrated database retrieval system