KEGG   Spirochaeta smaragdinae: Spirs_0224Help
Entry
Spirs_0224        CDS       T01287                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ssm00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229146..229820
Genome map
AA seq 224 aa AA seqDB search
MGRVKQELKELIVSTGVEMIKTGITVGTWGNISYRDPETDYMYISPSGMDYMKVKTDHVV
VMDLDLNIIEGEAEPSIEKHMHVAVYKARPDAHAVIHTHPTFSTVFGVAGLPLPAVSEDF
VQIVGEEIAIASPYALPGTPELGEVAVKGLGKNGAVLLPGHGALIAAANMPMALKISTVL
EKNAQIYLYAKLLGNGIRLFSREEIDAMQNFAKNHYGKKNQELV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagtaaagcaggagttaaaagagcttattgtttcaactggtgttgaaatgatt
aagacgggtattaccgtagggacatgggggaacatcagctatcgagaccctgagaccgat
tatatgtacatcagccccagcggtatggattatatgaaggtaaaaactgaccatgtcgtt
gtcatggaccttgatctgaatattattgagggtgaggcagagccttccattgaaaagcat
atgcacgttgcggtgtacaaggcacgtccggatgcccatgctgttattcatacccatccg
acgttttccaccgtttttggtgttgcgggtttacccctgcctgcggtaagcgaagatttt
gttcagatcgtgggcgaagagattgctattgcttctccctatgccctgcccggtactccc
gagctgggagaggttgccgtgaagggtctcggaaaaaatggtgccgttctgcttcccggt
catggtgctctcattgccgctgcgaacatgcctatggcacttaagatcagtacggttctt
gagaaaaatgcacagatatatctctatgcgaagttgttgggtaatggcatccgcctcttc
tccagagaagagatcgatgcaatgcagaattttgcaaaaaaccattacggcaaaaaaaat
caagaacttgtataa

DBGET integrated database retrieval system