KEGG   Spirochaeta smaragdinae: Spirs_0635Help
Entry
Spirs_0635        CDS       T01287                                 

Definition
alpha amylase catalytic subunit
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Spirs_0635
Enzymes [BR:ssm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Spirs_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
664640..666382
Genome map
AA seq 580 aa AA seqDB search
MNDVIVRLLTEIYGASQAEELAEEIGTLVAERRSHLIPPENRGRGDLPLDETDAFLITYG
DSFRRDGTVPLQGLREFADRKLTGIISGIHILPFFPYSSDDGFSVIDYEQVNGDYGDWKD
VAEIGASFKLMSDLVLNHCSAKSLWFRRFLEGDPLYRDFFVTASPDDDLSMVVRPRTHPL
LTPFETSEGVRHVWTTFSADQVDLNFANPAVMLEMIRILLFHIEKGIQVIRLDAIAYLWK
EIGHPSIHHPKTHAAVKLFRAVLDVAAPWVVVLTETNVPHEENISYFGNGSDEAHMVYQF
PLPPLVLDAFLEEDAAVLRKWASGLTGLSAKTTFFNFLASHDGIGVMPARGILPQDRIDR
LVNTTLKRGGLISYKATPEGSIPYEMNITYLDAVAEKELPDSVRARKFLASQSIMLALRG
VPGIYYHSLVGSENWREGVEDTGRNRTINRQKLQLDPLLETINEAGSLRNRIYSGFKAML
QARASTSAFDPAGRMEILPTEGAVFGLVRISPDKKERVVCLVNLAPVAKEATFPAIVLGG
KPASDFIDLIEDSSMVPLRTGKDLTFQLEPYGVRWIRPRN
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgtaatagttcgattattgacggaaatctatggcgcctctcaggcagaggaa
cttgccgaagaaatcgggacgcttgtcgccgagcggcgtagtcacctcattcccccggaa
aaccggggaagaggagatcttccccttgacgaaaccgatgcctttctcatcacctatggc
gacagctttcgccgggacggaaccgttcctcttcagggattgcgggagtttgccgaccga
aaacttaccggtatcatttccggtatacacatccttccttttttcccctactcctcggat
gatggtttttcggtcatcgactacgagcaggtcaacggcgactatggcgattggaaggat
gttgcggaaatcggcgcttcattcaagctgatgagcgatcttgtgctcaaccactgctct
gcaaagagcctgtggttccgccgttttctcgaaggcgatccactttaccgggactttttc
gttaccgcctcgccggatgacgatctctcgatggtggtgcgccctcgtacgcatcctctg
ctgactccctttgagacatcagagggagttcgtcacgtctggaccaccttttcagccgat
caggtggatctcaactttgccaatccggcagtcatgctcgagatgatacgtatcctcctt
tttcatattgaaaaggggatacaggtgatccgtctcgatgccatcgcctatctttggaag
gagatcggccatccttcgatccatcatccaaaaacccatgcggcggtaaagctttttcgt
gcggttcttgatgttgccgctccctgggtggttgtcctgacggagaccaacgttccgcac
gaagagaatatcagctacttcggcaatggaagcgacgaggcccacatggtctatcagttc
ccgcttcctcccctggtcctggatgcttttttagaggaagatgcagcggtattgcgaaaa
tgggcatcgggtttgaccgggctttcggcaaagaccacctttttcaatttcctggcaagc
cacgacgggatcggggtgatgccggcccggggaatccttccccaagatcggatcgatcgt
cttgtgaacaccaccctcaaacggggcgggctgatcagctacaaggccactccggaagga
tcgatcccttatgaaatgaatatcacctatctcgacgccgttgccgaaaaagagcttccc
gacagcgtcagggcgcgcaaattccttgccagccagtcgatcatgcttgccctgcgaggg
gttccgggaatctactatcactcgcttgtcgggtccgaaaactggagagaaggggttgag
gataccggacggaaccgtaccatcaaccggcaaaaattgcagcttgatccgcttcttgag
acgataaacgaggcgggatccttgcggaacaggatctacagcggctttaaggcaatgctc
caggccagagctagtacgtcggcctttgatcctgccgggcgcatggaaattcttcctacc
gaaggggccgttttcggtcttgtacgtatcagtcccgataaaaaggaacgggtcgtctgc
cttgtcaaccttgctcccgttgccaaagaagccacctttcccgcaatcgtactcggtggt
aagcctgcatccgattttatcgacctgatagaggattcgagtatggttcccctgagaacc
ggaaaagatctcaccttccagcttgaaccctacggtgtccgctggatcagaccacgaaat
tag

DBGET integrated database retrieval system