KEGG   Spirochaeta smaragdinae: Spirs_0645Help
Entry
Spirs_0645        CDS       T01287                                 

Definition
hypothetical protein
Orthology
K07793  
putative tricarboxylic transport membrane protein
Organism
ssm  Spirochaeta smaragdinae
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spirs_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
673997..675496
Genome map
AA seq 499 aa AA seqDB search
MLGNIVDGFYNFFHLSSFLYMNLGILLGIIFGAIPGLTVLLCIVLFLPFTYGLDPIPSFM
FLLGIYCAGSYGGSISAIMIKAPGTPHAAATLLDGAPLAAKGFAKKALKTALIASTIGGL
VSAIALLFISPFIAKVALHFGPPEYFILCLFGLSIVAGVSGTDLSKGIISSCIGLFLATV
GIDIMSGTFRFTFGNYNLFGGFDLVIIVTGLFAISETIMKAGFKKEAAKHKIDLAKMNKG
EDVTFRDFKRMVRPISRSSLIGIIIGAIPGTGASMASFFSYDQARKRSKHPEEFGKGSIE
GIAAAESANNAVTGATLIPLLTLGIPGDAVVAILVGAFMVNGLIPGPNLFVEHTVTIYAI
MVGLIFTNVFMFLQGNFLAKFFAKVALIPTEILTPIIVLLCLTGAYSINNSFFDVLVSVI
VGFVSYLLIRFDFSVIPVLLGLVLGPLAESNLRRSLLISHNDITIFFRRPISAFFIAILL
FSLVMVIVKNVKKKNSMRV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaaatattgtcgacggattttacaatttctttcatctttccagttttctgtat
atgaatcttggtatattattaggaataatttttggtgctattcccggcttaaccgttttg
ttatgcatcgttcttttcctcccttttacctacggacttgaccctattccctctttcatg
tttctgcttggaatttattgtgcaggaagctacggtggatcaatttctgcgattatgatt
aaagctccgggaactcctcatgcagcggcgactttattggatggcgcacctctcgccgca
aagggttttgccaaaaaggcgctgaaaaccgcactgatagcatcaactattgggggattg
gtaagtgccattgccctcctttttatatccccctttatcgctaaggtggcactgcatttt
ggcccacccgagtattttatcttatgcctctttggactttcaatcgtggcaggtgttagc
ggtacggatctttcaaaggggattatttcaagctgtatcggtttatttcttgcgaccgtg
ggtatcgatattatgagcggcacctttcgatttacctttggaaattacaatctttttggc
ggctttgatcttgttatcatcgtgacaggtctatttgcgatatcggaaaccatcatgaag
gcaggttttaaaaaagaggcagccaagcataaaatcgatcttgcgaaaatgaataaaggt
gaggatgttacgttccgtgatttcaagcggatggttaggcctatttcccgttcctctttg
ataggcattatcatcggtgcgataccgggaacgggggcatcgatggcatcgttcttcagc
tacgatcaggcaagaaaaagatcgaagcatcccgaagagtttggtaaaggatcgatcgag
gggatcgccgctgcggaatctgccaataatgcggttacgggagccacgcttataccgctt
ttgacgcttggcatcccaggtgatgctgttgtggccatcctggttggtgctttcatggtg
aacggactgattcccgggccgaacctgtttgtggaacatacggtcactatttatgccatt
atggtcggattaatttttacaaatgtattcatgttcctgcaaggtaatttccttgctaag
ttttttgcgaaagttgctttaatccctacggaaattctgaccccgattatcgtccttttg
tgtctgaccggggcatattccataaataattctttcttcgatgttttggtttctgtaatc
gtaggtttcgtctcgtaccttttaatacgtttcgatttttccgtcattccggtcttactt
gggcttgtccttgggccattggcggagtcgaaccttaggagatctctcctaatatcgcac
aacgatattacaattttctttcgtcgtccgatcagtgctttttttatagcaatattactc
ttttcccttgtcatggtaattgtcaagaacgtaaagaagaaaaacagcatgcgggtataa

DBGET integrated database retrieval system