KEGG   Spirochaeta smaragdinae: Spirs_0799Help
Entry
Spirs_0799        CDS       T01287                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Spirs_0799
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Spirs_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
827353..828402
Genome map
AA seq 349 aa AA seqDB search
MTLKRTLIQSGRKEANLRRPRILVVGSFVMDLIVTTEFFPCSGETVLGKSFRTAAGGKGA
NQAVQASRLGAEVKMSGKVGNDEFGKTLIASCKSSGIDVESVAVDDLVSSAVGDVILEES
RGGGAKNRIIVVPGANMTIRVEEIAFIERILERYDMVMLQLEIPMAINEQIARYAAEKGV
PVMLNSAPSAPLSDELLGCLAYICPNEHEAEAITGVAIRKNDGEANKDDIYSMAEVLLKK
GVENVLVTLGSGGAALVNRDEFFLQPCIDVVEVKDPTAAGDSFVGSFVTGVCAGMDHEQA
LVFASYAATLAVSKTGAQPSLPYLTEVIDLLVREGEQRVDFQLLEILKR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgaaaaggactctcatacagtccgggagaaaggaagcgaatctgaggcggccc
cggatattggtagttggaagctttgtgatggaccttattgttaccacagaatttttcccc
tgctctggggagactgttttggggaaatctttccggacagctgcgggaggtaagggagca
aatcaggccgtacaggcctcccgtttaggtgccgaagtaaaaatgtcgggtaaggttggc
aatgatgaattcggcaagaccttgattgcctcgtgtaaaagttctggaattgatgtcgaa
tctgtagctgttgatgatcttgtctcctctgcagtgggagacgtgatactcgaagaatcg
agaggtgggggggcaaaaaatagaattatcgtggtgccgggtgccaatatgacaatccgg
gtggaagagatcgcttttattgaaaggatcttggagcgatatgacatggtaatgctccaa
ttggaaattccgatggcgattaatgaacagattgcccgatatgctgccgaaaagggggtt
cccgtgatgctcaattctgcaccgtcggcgcccctgtcggacgagttgcttggttgcctt
gcatacatttgtcccaacgagcatgaggcggaagccattaccggagtagccatcaggaaa
aacgatggcgaggcaaataaagatgatatctattctatggcagaagtactgctgaagaag
ggcgtggaaaatgtgcttgtcaccctgggaagcgggggggcagccctggtaaacagagat
gaatttttcttgcagccctgtatcgatgtagtggaagtcaaggacccgacggcagctggt
gattcgtttgtcggatcgtttgtgacgggagtttgcgcgggcatggatcatgaacaagcc
ctggtatttgcaagctatgccgcaacgttggcagtttcaaaaacaggagcacagccttca
ttaccatacttgacggaagtcattgatttactggtacgcgagggagagcaacgagttgat
tttcaacttttagagatattgaaaaggtag

DBGET integrated database retrieval system