KEGG   Spirochaeta smaragdinae: Spirs_0837Help
Entry
Spirs_0837        CDS       T01287                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Spirs_0837
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spirs_0837
   00600 Sphingolipid metabolism
    Spirs_0837
Enzymes [BR:ssm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Spirs_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
867274..868620
Genome map
AA seq 448 aa AA seqDB search
MTKVVIIGAGSAMFTKNLVGDLLYYDDMEIDNISLVDIDAEKLAVMEKVTKKIVKQFGRK
TVVESSTDRCKVLKDATFVTSTVGVGGVEMYEKDLEIPDKYGLHQCVGDIIGPGGMFRFL
RAYPVLLDICKDMERLCPDAYFFNYTNPMAPLCLALNHATSIKVFGFCHNVQSTALQLSA
YMGVDRSRVSYWAAGINHMDWFLQLKVDGKDAYPQLKEISKDKEKVKKLWQVEPDYSKYE
LDPHVRLVDLIRFEVMDNFGKYVSESPFHMGEYCPYFRKNPDMIKEYQVDDRWWLRHEKY
TDVYYHKLVGMLESGEDIEVAKTFEYAPEIIHAYVTGKPFRANLNVKNTGLIPNLPADSV
VEVACYTDSEGIHPCYVGEIPQQLAALNITNINMHKLMAMAGNEKKLSMIYDAVKMDPLT
AAMCTLGQINDMVAELIEANKEYLKDFT
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtagtgattatcggtgctggcagtgcaatgtttacgaagaacctggttgga
gatctcttgtactacgacgatatggagatcgacaacatttctctggtcgatatcgatgcg
gagaaactggctgtcatggaaaaggtaacgaaaaagatcgtgaaacagttcggcagaaaa
actgttgttgaatctagtaccgatcgatgcaaagttctaaaagatgcaacatttgtaacc
agtacagttggcgtcggtggtgttgagatgtacgagaaggatcttgaaatccccgacaaa
tacggactgcaccagtgcgtgggggacatcattggtcccgggggaatgttcaggtttcta
agggcctaccccgtacttctcgatatctgtaaggatatggaaaggctttgtcccgatgca
tatttcttcaactacacaaacccaatggcacctctgtgtcttgctctgaaccatgcaact
tccatcaaggttttcggcttctgccacaacgtccagagtaccgccttgcagctctcagcc
tatatgggtgttgaccgaagtcgggtctcctactgggcggccggtataaatcatatggac
tggtttctgcaactgaaggtggacggcaaggatgcatatccccaactcaaggaaatctcc
aaggacaaggagaaggtgaagaagctctggcaagtagaaccggattacagcaagtatgaa
cttgacccccatgtcaggcttgtcgacctcatcaggttcgaggtcatggacaacttcggg
aagtatgtttcagaatcaccttttcatatgggggaatattgtccctatttccgcaagaat
ccggacatgatcaaggaatatcaggtggatgacagatggtggctgaggcatgaaaaatac
accgatgtctactaccacaaacttgtcgggatgctggaatcgggcgaagacatcgaggtt
gcgaagacctttgaatatgcgccggagatcattcatgcctatgtgacgggcaaacccttc
agggcaaatctcaacgtgaagaacaccggcctgattccgaacctgccggccgattcggtt
gtcgaagttgcctgttacaccgacagcgaggggatccatccctgttacgtgggtgaaata
cctcaacagcttgcggcattgaatataaccaacatcaacatgcacaaactcatggccatg
gcagggaacgaaaaaaagctatccatgatatacgatgctgtgaagatggatccgctaaca
gccgctatgtgcacattgggccagatcaacgacatggttgcagagctcattgaagccaac
aaagagtacttgaaagactttacctga

DBGET integrated database retrieval system