KEGG   Spirochaeta smaragdinae: Spirs_0883Help
Entry
Spirs_0883        CDS       T01287                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spirs_0883
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spirs_0883
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spirs_0883
Enzymes [BR:ssm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spirs_0883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
927111..928601
Genome map
AA seq 496 aa AA seqDB search
MAEITYHSTRDAAREAIPFSQAVVRGIAPDGGLYVPSSFPGLDITDPQLAALDYEGLAEK
VLSLLITDFSKEELSSCVHRAYGSGFRHPGVAPIHSCGNVHFIELYHGPTLAFKDMALSI
LPHVLTTAAGKLGIDDTIVILTATSGDTGKAALEGFADVPGTQIVVFYPTDGVSEVQKRQ
MTTQEGANTHVVGITGNFDDAQNGVKAIFADGKIRERIARRGYRFSSANSINPGRLLPQI
VYYINGYLELVRRNTILPGEKVHVVVPTGNFGNILAAWYARHMGLPVGRFICASNSNNVL
TDFMRTGRYSLDRRFSPTISPSMDILISSNLERFLYELADRDPAKVVSLMSDLKNDGVYE
IDRTMMKNMADFYGGFADDTATVSAIEELYRTYGYVVDTHTAVGYRVYQDFLRETGDDRP
VLLASTASPFKFSRSVAEAVGVPVEGKSDFELIDLLAERCCLDIPAPIRGIADRSIRHPE
TCKKDEMARVVEELLS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcagagattacctatcacagcacaagggacgccgcacgtgaggcaattcccttttca
caggccgttgtacggggtattgctcccgacggcggcctctatgttccctcctctttccca
ggcctcgatatcaccgacccgcagcttgctgctcttgattacgagggacttgcggagaag
gtcctttcccttctgattaccgatttctcgaaagaggagctctcctcctgtgtccatcgg
gcctatggctcgggctttcgtcaccctggggtggcaccgatacatagctgtgggaatgtt
cactttatcgagctctaccatgggccgaccctggcctttaaggatatggccctctctatt
ctcccccatgttctcacaaccgccgccggaaagcttgggattgatgacaccatcgtgatc
cttaccgccaccagcggtgatacgggaaaggctgcccttgagggctttgccgatgttccg
ggaacgcaaatcgtggtattttatcccaccgatggagtcagtgaggtccagaagcgtcaa
atgacgacccaggaaggggccaatacccatgttgttgggattaccggtaattttgatgat
gcccagaacggcgtcaaggcgatttttgccgatggcaagatacgggaacggatcgcccga
aggggctaccgcttttcctctgccaattccattaatccggggagacttcttcctcagatt
gtgtactatatcaacggctatcttgaacttgtacgacgaaatacaattctgccgggggaa
aaagtacatgttgtcgtgccgaccggtaatttcggcaatatccttgcagcctggtacgcc
cgtcacatggggctgccggtggggcgctttatctgtgcttcaaacagtaataacgttctt
accgattttatgcggaccgggcgctatagcctggatcggagattttctcccaccatcagt
ccctccatggatattctcatctccagcaatctcgaacgatttctttacgagctggccgac
cgggaccctgcaaaggttgtctcccttatgagcgacctaaaaaatgacggtgtctatgag
atcgatcggacaatgatgaaaaacatggccgatttttatgggggctttgccgacgatacg
gcaaccgtatcggcaatcgaagagctatatcgtacatatggttatgtggtggatacccac
accgccgtcggatatcgagtctaccaggattttctgcgggaaaccggggacgaccggccg
gtactccttgcctcgacggcaagtccctttaagttcagcaggagtgttgccgaggcggtt
ggtgtccctgtggagggaaagagcgattttgaattgattgacctccttgcggagcggtgc
tgtcttgatattcctgctccgatcagaggaatcgcggatcgttctattcgtcatcctgaa
acctgcaaaaaagatgaaatggcaagggtcgtagaggagcttttatcatga

DBGET integrated database retrieval system