KEGG   Spirochaeta smaragdinae: Spirs_0990Help
Entry
Spirs_0990        CDS       T01287                                 

Definition
glyceraldehyde-3-phosphate dehydrogenaseI (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ssm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssm00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1034893..1035915)
Genome map
AA seq 340 aa AA seqDB search
MVKVGVAGYGVIGQRLADGVARQKDMELVGVADVAPTLPVRALAEKGMPYKLFTAVPEKR
NLLDDVGIPVSGTLEELVQEVDIMLDATNAGVGAKNKEIYQKYNTKAVFQGGEKNNVADV
FFHGYANYEKGIGADYLKLTSCNTTGLIRAIDAIDRAVGVVKTAITIIRRVADPGDYHRG
LTNALQVAEAPNHQALDLMTIMPHVDATGILIHTPVTHGHIITPVVTTKKKMHKEELLEI
FKAHPRIRVVRLADGFLGNASLFKYARDLGHPRGDMYEIAVWEETIVNSGDDIMFAINIP
QEAVVIPENMDAIRAALKMQTSRDEGVAKTNEYLGMKARG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggttggagtagccggatacggagttattggccagagattggccgacggagtt
gcacggcagaaagatatggagctggtcggggtcgccgacgttgcccccacccttcccgtt
agggcccttgcggaaaaaggaatgccctataaactttttacggcggtaccggaaaagaga
aaccttctggatgatgtgggaattccggttagcggaaccctcgaagaacttgtccaggaa
gtggatatcatgctggatgccaccaatgccggtgtcggagcaaagaacaaagagatctac
caaaaatacaacaccaaggcggtattccagggtggagaaaaaaacaatgttgcagatgtc
tttttccacggctatgcgaactacgaaaagggtattggggctgactacctcaagctcacc
agctgcaacacaacagggctcatcagggccatcgacgccatcgacagggccgtcggtgtt
gttaaaacggccattaccatcatccgaagggttgcggacccaggtgactatcatagggga
ttgacaaatgccctgcaggtagcagaagcgccgaaccatcaggccctcgaccttatgacc
atcatgccccatgtcgatgcaacaggaattctcatccataccccggtgacccacggacat
atcatcacccccgtggtaactaccaagaagaagatgcacaaagaggagctcctcgaaatc
ttcaaggcacatccccgtatccgtgtggtacgtctggcggatggcttccttggaaatgca
agcctctttaaatacgccagggacttgggccatccccgcggtgatatgtacgagattgct
gtgtgggaagagactattgtaaacagcggtgacgatattatgttcgccatcaacattcct
caggaagcggttgttatccccgaaaatatggatgcaatccgtgccgcgttgaagatgcag
acaagccgggacgaaggtgtagcaaagaccaacgaatatctcggaatgaaggccaggggt
taa

DBGET integrated database retrieval system