KEGG   Spirochaeta smaragdinae: Spirs_1035Help
Entry
Spirs_1035        CDS       T01287                                 

Definition
aspartate/ammonia ligase (EC:6.3.1.1)
Orthology
K01914  
aspartate--ammonia ligase [EC:6.3.1.1]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Alanine, aspartate and glutamate metabolism
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssm01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ssm00250]
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:ssm00460]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1081519..1082538)
Genome map
AA seq 339 aa AA seqDB search
MIDGYKQQLGLMATERGIKLIKDTFEQELSRGLDLQRVSAPKFLEVGDGLQDDLAGTQEP
VSFRVKHRPANIEIVHSLAKWKRMALSRYGFAPDTGLYTDMDAIRKDEDVSEIHSIYVDQ
WDWEKRITPEYRNLDYLKETVRSIYLAMKKTEQIVHEAFPIIEPRMPHQITFIHSAELEK
RWPEHTPKEREELAAKEYGAFFLIGIGAKLASGKPHDLRAADYDDWITENSDGYQGLNGD
IIVFDHTRGRAMELSSMGIRVSPESLKAQLREMGQEERLSWSFHRGVIDGSMPLSIGGGI
GQSRLCMLLLHKMHIGEVQASIWPDSMIEEYAKIGVSFL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacggatataaacaacagttgggattaatggccaccgaacgcggtattaagctg
atcaaggatacctttgagcaggagctgtccagaggactcgatctgcagagggtcagcgcc
cccaaattcctcgaggtgggagacggtcttcaagacgatcttgcaggaacccaggaaccg
gtcagttttcgcgtcaaacaccgcccggctaacatcgaaatcgtacatagccttgcaaaa
tggaaaagaatggccctttccaggtacggctttgctccggatacgggcctgtacaccgat
atggatgcgatacgaaaggatgaggatgtcagcgaaatccacagtatctacgtcgaccag
tgggactgggaaaaacgcatcacccccgaatatcgaaatcttgactacctcaaggaaacg
gtacgttcgatctatcttgcaatgaaaaagacagagcagattgtccacgaagcatttccc
attatcgaacctcgaatgcctcaccagattaccttcatccactccgccgaattggaaaaa
cgatggccggaacataccccaaaagaacgtgaggagctggctgcaaaggagtatggagct
ttctttctcatcggtatcggtgcaaaacttgcatcgggtaagccccacgatctgagggcc
gccgactacgacgactggatcaccgaaaacagcgacggctatcaggggctaaacggcgac
atcattgtctttgatcacaccaggggacgggccatggaactctcatccatggggattcgt
gtctccccggaatcgctaaaggctcagctcagggagatgggccaggaagagcggctctcc
tggagcttccaccggggtgttatcgacggctccatgcccctctccatcgggggaggaata
ggccagagcaggctttgtatgttactgcttcataagatgcacatcggagaggttcaggca
agtatctggccggattcaatgatcgaagaatacgcaaaaatcggggtctcctttctataa

DBGET integrated database retrieval system