KEGG   Spirochaeta smaragdinae: Spirs_1035Help
Entry
Spirs_1035        CDS       T01287                                 

Definition
aspartate/ammonia ligase (EC:6.3.1.1)
Orthology
K01914  
aspartate--ammonia ligase [EC:6.3.1.1]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Alanine, aspartate and glutamate metabolism
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spirs_1035
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spirs_1035
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Spirs_1035
Enzymes [BR:ssm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.1  aspartate---ammonia ligase
     Spirs_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1081519..1082538)
Genome map
AA seq 339 aa AA seqDB search
MIDGYKQQLGLMATERGIKLIKDTFEQELSRGLDLQRVSAPKFLEVGDGLQDDLAGTQEP
VSFRVKHRPANIEIVHSLAKWKRMALSRYGFAPDTGLYTDMDAIRKDEDVSEIHSIYVDQ
WDWEKRITPEYRNLDYLKETVRSIYLAMKKTEQIVHEAFPIIEPRMPHQITFIHSAELEK
RWPEHTPKEREELAAKEYGAFFLIGIGAKLASGKPHDLRAADYDDWITENSDGYQGLNGD
IIVFDHTRGRAMELSSMGIRVSPESLKAQLREMGQEERLSWSFHRGVIDGSMPLSIGGGI
GQSRLCMLLLHKMHIGEVQASIWPDSMIEEYAKIGVSFL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacggatataaacaacagttgggattaatggccaccgaacgcggtattaagctg
atcaaggatacctttgagcaggagctgtccagaggactcgatctgcagagggtcagcgcc
cccaaattcctcgaggtgggagacggtcttcaagacgatcttgcaggaacccaggaaccg
gtcagttttcgcgtcaaacaccgcccggctaacatcgaaatcgtacatagccttgcaaaa
tggaaaagaatggccctttccaggtacggctttgctccggatacgggcctgtacaccgat
atggatgcgatacgaaaggatgaggatgtcagcgaaatccacagtatctacgtcgaccag
tgggactgggaaaaacgcatcacccccgaatatcgaaatcttgactacctcaaggaaacg
gtacgttcgatctatcttgcaatgaaaaagacagagcagattgtccacgaagcatttccc
attatcgaacctcgaatgcctcaccagattaccttcatccactccgccgaattggaaaaa
cgatggccggaacataccccaaaagaacgtgaggagctggctgcaaaggagtatggagct
ttctttctcatcggtatcggtgcaaaacttgcatcgggtaagccccacgatctgagggcc
gccgactacgacgactggatcaccgaaaacagcgacggctatcaggggctaaacggcgac
atcattgtctttgatcacaccaggggacgggccatggaactctcatccatggggattcgt
gtctccccggaatcgctaaaggctcagctcagggagatgggccaggaagagcggctctcc
tggagcttccaccggggtgttatcgacggctccatgcccctctccatcgggggaggaata
ggccagagcaggctttgtatgttactgcttcataagatgcacatcggagaggttcaggca
agtatctggccggattcaatgatcgaagaatacgcaaaaatcggggtctcctttctataa

DBGET integrated database retrieval system