KEGG   Sediminispirochaeta smaragdinae: Spirs_1093Help
Entry
Spirs_1093        CDS       T01287                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
ssm  Sediminispirochaeta smaragdinae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1149621..1150238)
Genome map
AA seq 205 aa AA seqDB search
MVLYLIRHAESVANKERILASRLPYHLTAEGKHDADLIASELKRETSLDRIISSPLVRAV
ETAESFGKAFSLPIETDDRLSEHDLGIFSGKGYDEVKTIESYESDPLKRWDWCPEGGESY
AMIAARVKDFLHSLEELPANQKVLIVTHAIALRLIHAVLKHTLPHYPTTFPNNGEIWKVD
FTKTGAVHEIKSLLLGNSRDFMHRP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggtactctatcttatccgtcatgcggagagtgttgcaaataaggaacgcattttggca
agcaggcttccgtatcacctcaccgccgaaggaaaacacgatgcagatttaatagcatcg
gaattgaaacgggagacctctctggacaggatcatctcatcgccgcttgtacgggcggtt
gaaacggcagagtccttcggcaaggccttctcactccctatcgagaccgatgatcgatta
tcggaacacgaccttggaattttttcgggaaaagggtacgacgaggtaaaaaccattgaa
tcatacgaaagcgatcctcttaagcgatgggattggtgtcccgaagggggagaatcctac
gccatgatagccgccagggtaaaagattttctccactccttggaagagctcccggcgaat
cagaaggtcctcattgtgactcacgccattgccctcaggcttattcatgccgtcttgaaa
cataccctcccccactatccgaccacgtttccgaacaatggcgagatatggaaagtcgat
ttcaccaagacaggagcggtacatgaaataaaatccctgctgttgggcaacagcagggat
tttatgcaccggccttag

DBGET integrated database retrieval system