KEGG   Spirochaeta smaragdinae: Spirs_1162Help
Entry
Spirs_1162        CDS       T01287                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssm  Spirochaeta smaragdinae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spirs_1162
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Spirs_1162
Enzymes [BR:ssm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Spirs_1162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1219400..1220902
Genome map
AA seq 500 aa AA seqDB search
MDFDELIGNVFMLGLPSSVLDDVGKDVLAAVRPGSVILFSRNIVDREQVARFIEEITTFL
GYKPLIAIDQEGGIVTRLKKGFTVSPGAMALAATGDPHNAYLAGKLLGQEMKAVGIDWNL
APVVDINSNPLNPAIGIRSFSENADVVIAYASQFAAGLEKSGILTCLKHFPGNGRVQVDP
HLDMPSLDISREALFRNEMLPFLSIPAPSWMPTHIYVPTLQSRREAVTVSREVLTGLVRD
KLKYKGLLVSDDLNMGGVAHVLRADDLAVETLAAGMDMISFCDNPEKQLMAASAVAGRVA
RDEVFAERVRQASARVKTMCSLRDRADGSRSSLVDFEANGRKMDFISLKSVRLVKNEEQA
VPLCSVDNVFTMRSSRLVLIEEGSEGIPAVASRAAEKLSCPLSIYERTITDAEAAVLKRQ
AKGKSNLIFTENAHLEPSLVRFIEDLAQISGRLVLVALRNPYDTDIAGIQNAVASYGYTA
AQQEGVMRLLFPGAFEEGCV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgatgaactgatcgggaatgttttcatgctgggcctgccttcttcagtgctt
gacgatgtgggaaaggatgttcttgccgccgtcagacccggatcggtcattttattttcc
agaaatatcgttgacagggagcaggttgcccggtttatcgaagagataacgacttttctc
ggatacaagccgctcattgcgatcgatcaggaaggtggtattgtcacaaggctgaaaaag
ggatttaccgtttctcccggcgccatggctctggccgcaaccggcgatccccataatgca
tacctggcgggaaaactgctcggccaagaaatgaaggccgtaggcatcgactggaacctc
gcccccgttgtcgatatcaacagcaatccgcttaatcctgccatcgggattcgcagtttt
tccgaaaatgccgatgttgttattgcctatgcatcacagtttgccgcaggccttgagaaa
agcggcatcctgacctgcctgaagcattttccgggcaacggccgggttcaggttgatccc
cacctcgatatgccctctctggatatttcccgggaagcgttgttccgtaatgagatgctt
ccctttctctctattcccgctccttcctggatgcccacccacatctatgtgcccacatta
caaagccgcagggaggctgttaccgtttcaagggaggtcctgaccgggctggtcagagac
aagctgaaatacaaggggcttttggtttctgatgatctgaacatgggcggcgtggcacat
gttctccgggccgatgaccttgcggtcgagaccttggcagcgggtatggacatgatttcg
ttctgtgacaacccggaaaagcagctgatggcagcctctgccgttgccgggagagttgcc
agggacgaagtgtttgcggagcgggtaaggcaggcctcggcgagggtgaaaacgatgtgt
tcccttcgtgacagggcggacggttctcgttcctcccttgttgattttgaggcgaacggg
cgaaagatggatttcatttccctgaaatcggtgcggcttgtaaaaaatgaggaacaggcc
gttcccctttgttccgtggataatgtgttcaccatgagaagcagccgacttgttctcatt
gaagagggcagtgaaggaatccctgcggttgcgtcccgtgccgccgaaaagctttcctgt
cccctttccatatacgaaagaaccatcaccgatgcagaagcggcggttttaaagcggcag
gcgaagggaaagtccaatcttatctttacggaaaatgcccatctcgaaccgtctctggta
cggttcatcgaggatctggcacagatatcaggcaggcttgtacttgtcgccctgcgaaac
ccatacgatacggatattgcgggaatacaaaatgcggtcgcctcgtatggctatactgcg
gctcagcaggaaggggtgatgaggcttctttttccgggagccttcgaggaaggttgtgta
tga

DBGET integrated database retrieval system