KEGG   Spirochaeta smaragdinae: Spirs_1173Help
Entry
Spirs_1173        CDS       T01287                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Spirs_1173
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Spirs_1173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1232262..1233179
Genome map
AA seq 305 aa AA seqDB search
MERKPRIQVIGSYAVGMTMGTDRFPKEGETVPGYGFCQLHGGKGSNQAVGAARGGGEVHF
TSCIGRDRMGDDAISMLRKEGIGTETVFRNSEASTGVGFVMVGSSGENEILIDLGANEKL
GRDHIDTIFTSSPLPEIILVQLEANLDAVHYAIRRADEKGIPVVLNPAPFRAVPDEMVAA
ASYITPNQTEAQSLLGKNADPQILCKELTAKYGNTVILTAGKHGAFIMEDGEAVAIPVPE
VTVKDTTGAGDCFNAALTVALAEGKGLRDAVTFANAAASLSVQVPGVIESLPFRDAVEDF
LKQQR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggaacggaaacccagaatacaggtaattggcagctacgctgtggggatgaccatggga
acggaccggtttcccaaggagggcgaaaccgtacctggctacggcttttgtcagctgcac
ggaggaaaaggttcaaaccaggccgtcggtgcggcaaggggtgggggggaagtccatttt
acttcctgcatcggccgggatcgaatgggagacgatgcgatatcgatgctccgcaaagaa
ggaatcggaaccgaaacggtgtttagaaactccgaggcctctacaggagtaggctttgtc
atggtcggttccagtggggagaatgaaattcttatcgatttgggggcaaacgaaaaactg
ggccgagaccatatcgatacgatttttacttcttctccactccctgagatcatcctggtg
cagcttgaggcaaacctcgatgctgttcactatgccatcagacgtgcagacgaaaaaggc
attcccgtggtcctcaatccggcaccctttcgtgccgttcccgatgaaatggttgctgcg
gcaagctacatcaccccgaatcaaaccgaagcccagtcactccttggtaaaaatgccgat
ccccagatcctctgcaaggagctgaccgcaaaatatggcaacaccgttattctgaccgcc
ggtaagcatggtgctttcatcatggaagatggcgaagcggtggctattcctgttcccgaa
gtgacggtgaaggataccacgggagcgggagactgctttaatgcagcccttaccgtcgcc
ttggcagaggggaagggacttcgcgatgccgtcacctttgccaatgcggcagcaagcctt
tcggttcaggttccgggggttattgaatccctgcccttcagggacgcggtcgaagatttc
ttaaaacagcaacgttag

DBGET integrated database retrieval system