KEGG   Spirochaeta smaragdinae: Spirs_1177Help
Entry
Spirs_1177        CDS       T01287                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Spirs_1177
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Spirs_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1235625..1236515)
Genome map
AA seq 296 aa AA seqDB search
MKILNYGSLNIDHVYRVPHIVRPGETLSSGDLKLFAGGKGANQSVAIAKTGVEVWHAGKV
GGDAQWLLDILKDAGVHTDLVRVWDGPTGHAIIQVAESGENSIVLFGGGNQHIEVGEIEA
TMESFGTGDVLVLQNEINNVPEIMKAAAKKGMKIYLNPAPFSEEVLSWPLELLDTLVVNE
TEGMELAKSEGTPEEVLDRLTSRYPDIDIIMTAGKQGAYYGRGKAREYVPIVDAPVVDTT
AAGDTFLGYYLASRIAGASPRAAMERATVASSITVSRPGAMESIPTASEVDKKLGL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctgaactacggctcactgaacatcgatcacgtttaccgggtaccccacatc
gtacggccgggagaaaccctttcgagcggagacctcaagctttttgcaggtggtaaaggg
gcaaaccagtccgtagccatcgcaaaaacaggagtggaggtatggcatgcgggaaaggtg
ggcggcgatgcacaatggctccttgatattctgaaggatgccggtgtacataccgacttg
gtacgagtatgggacggacccacgggacacgccatcatccaggttgcagagagcggggaa
aactccatcgtgctcttcggcggtgggaaccagcatatcgaggtgggggagattgaagcg
accatggaaagcttcggaacgggagatgtgcttgttcttcagaacgaaatcaacaatgtt
ccggagatcatgaaggcagcggcaaaaaagggaatgaaaatatacctcaatccggctccc
ttctcggaagaggttctctcctggcctcttgagcttctggataccctggtggtaaacgaa
accgagggaatggaactggccaaaagcgaaggaacgcccgaagaggttctcgaccgtttg
acctcacgctacccggacatcgacatcatcatgacagcaggcaagcagggcgcctattat
ggacggggaaaagcacgtgaatatgtaccgatcgtcgatgcgcccgtggtagatactact
gcggcaggagacacctttctcggctattaccttgcttccagaatagcaggagcctctccc
agggcggcaatggaacgggcaacggtggcctcttccatcaccgtatcccgtccaggagcg
atggagtcgatcccaactgcttccgaagttgataagaaactcggcttgtag

DBGET integrated database retrieval system