KEGG   Spirochaeta smaragdinae: Spirs_1384Help
Entry
Spirs_1384        CDS       T01287                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssm  Spirochaeta smaragdinae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spirs_1384
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spirs_1384
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spirs_1384
Enzymes [BR:ssm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spirs_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1472539..1473759)
Genome map
AA seq 406 aa AA seqDB search
MEFHYICNDCGAEYDSKHIIYRCPACSGKAAEGEMQRGNLRTIIDPAYLKSLADKKNLSP
FDFFPYEIPTPQAYPVGNTPLLGPERLRKRYKVPRLFLKNDGMNPSGSFKDRASQLVVGQ
ALHFGEQKVALASTGNAGSAMACAGAAYGLEIILFVPETAPRNKLMQSVLYGATVVPVKG
TYDDAFGLSIEFTEKHGGINRNTAYNPMTVEGKKSVAIELFLQFARRAPEYVYVPVGDGV
IYSGVVKGFKDLLDAGLIERLPKVICVQSTKSNAIAQAWESGEAKTIPAATTKADSISVA
SPANGRMAVDFINECKGWASQVSDEAIIEAELELCKEAGLFAEPAASAAWAGYKQDLASG
KITPEAEAVVLLTGIGFKDMKAVEDTIKMPNSVEPKLDAVEAFLFK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggagtttcattacatatgtaacgactgcggagcagaatacgactcgaagcatatcatc
taccgctgcccggcctgcagcggaaaggcagcagagggagagatgcaacggggaaacctg
cgtaccatcatcgatcctgcctatcttaaaagcctggcggacaaaaaaaacctttcgccc
tttgacttctttccctatgagatccccacaccccaggcatatccggtagggaatactccc
cttctcggtcccgagcggctgagaaaaagatataaggtccccaggctgtttttgaaaaac
gacggcatgaacccgtccggttcctttaaagatagggcaagccagcttgtggtggggcag
gccctccacttcggggaacaaaaggttgccctcgcttcgacggggaatgcaggcagtgcc
atggcctgtgcgggagccgcctacgggttggagatcatactgtttgttccggaaacggcg
ccgaggaacaaattgatgcagtcggtgctttacggagcaacggtagttccggtaaaggga
acctatgatgatgccttcggactttccatcgagtttaccgaaaaacatgggggcatcaat
cggaacaccgcctacaatcctatgaccgtcgaaggcaaaaagagcgtggccatcgaactc
ttcctgcagtttgcaaggcgtgcacctgagtatgtctatgtgccggtgggggatggagta
atctacagcggcgtggttaagggcttcaaggacctcctcgatgcaggattaatcgaacgc
ttgccgaaggttatctgcgttcaatcgacaaaaagcaacgcaatagcccaagcctgggag
agcggtgaggcaaaaaccatcccggcggcaacgacgaaggccgattccatcagcgtggca
agccccgccaatggccgcatggctgttgactttatcaacgagtgtaagggctgggcaagc
caggtgagtgacgaggctatcatcgaagcggagcttgaactctgcaaagaggcaggcctt
tttgcagaaccggcagcctcggcagcatgggccggatacaaacaagatctggcttcaggc
aagatcactccagaagcggaagcggtcgtccttcttaccggcataggctttaaggatatg
aaggctgtggaagatacgataaagatgcccaacagcgtcgaaccgaagctcgacgctgtt
gaggcctttttgttcaaatag

DBGET integrated database retrieval system